[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82250.1
DDBJ      :             NADH-quinone oxidoreductase chain M
Swiss-Prot:NQO13_THET8  RecName: Full=NADH-quinone oxidoreductase subunit 13;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I chain 13;AltName: Full=NDH-1 subunit 13;

Homologs  Archaea  31/68 : Bacteria  653/915 : Eukaryota  42/199 : Viruses  0/175   --->[See Alignment]
:469 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   199->405 2c1wA PDBj 6e-04 8.2 %
:RPS:PFM   117->374 PF00361 * Oxidored_q1 4e-10 30.8 %
:HMM:PFM   112->382 PF00361 * Oxidored_q1 1.7e-51 32.2 267/270  
:BLT:SWISS 42->469 NQO13_THET8 0.0 99.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82250.1 GT:GENE AAS82250.1 GT:PRODUCT NADH-quinone oxidoreductase chain M GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1816354..1817763) GB:FROM 1816354 GB:TO 1817763 GB:DIRECTION - GB:PRODUCT NADH-quinone oxidoreductase chain M GB:PROTEIN_ID AAS82250.1 GB:DB_XREF GI:46197838 LENGTH 469 SQ:AASEQ MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIALTVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLHLYGGEGRTRALYTFVLFTLVGSLPMLAAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFAFFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGVYTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVIASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA GT:EXON 1|1-469:0| SW:ID NQO13_THET8 SW:DE RecName: Full=NADH-quinone oxidoreductase subunit 13; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I chain 13;AltName: Full=NDH-1 subunit 13; SW:GN Name=nqo13; OrderedLocusNames=TTHA0096; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane; NAD;Oxidoreductase; Quinone; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 42->469|NQO13_THET8|0.0|99.8|428/469| GO:SWS:NREP 7 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 11 TM:REGION 10->32| TM:REGION 61->83| TM:REGION 106->128| TM:REGION 146->168| TM:REGION 187->209| TM:REGION 253->275| TM:REGION 282->304| TM:REGION 309->331| TM:REGION 349->371| TM:REGION 390->412| TM:REGION 427->449| SEG 2->41|vvlavllpvvfgallllglpralgvlgaglsfllnlylfl| SEG 96->116|lglallmeglllglfaardll| SEG 253->272|faqaqglllflaalsalyga| SEG 351->364|apglaalalilfla| SEG 433->442|allsvlalll| RP:PDB:NREP 1 RP:PDB:REP 199->405|2c1wA|6e-04|8.2|196/273| RP:PFM:NREP 1 RP:PFM:REP 117->374|PF00361|4e-10|30.8|247/268|Oxidored_q1| HM:PFM:NREP 1 HM:PFM:REP 112->382|PF00361|1.7e-51|32.2|267/270|Oxidored_q1| GO:PFM:NREP 3 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF00361|IPR001750| GO:PFM GO:0042773|"GO:ATP synthesis coupled electron transport"|PF00361|IPR001750| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00361|IPR001750| OP:NHOMO 1208 OP:NHOMOORG 726 OP:PATTERN 1111-1---------12-1-----12221121-----------2----12422-22-2232---1-11 32313212111---31111-13--131111113343333211111223221-112111--33111212343--------1--42211222111---1--2-11--22231--------------1412413311245553411142455444444443333335444555322222222222211111--2-2111111111111111142112211121224-2-1111111-111111111111111112---------------------------------------------------------------------------1-----------------------2--113342---212--1----251111111111112213314434233333333333-11111122113112234343224313122234132221111111111222-32341111111111111111111111111111111111-122222222222111122232222122242123111111111111222122412111211111111222143-1-2-3-121--1-323245317222217-3132211111111111-11111311211111-2--2----------1-----111-121--722311-11111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111113333211114--1-----1----------22222221111-222211112111111111111111111----11111-----22222222221111112-111111------------------------------------1--1-1-1--241 --------------1--1---------1---11111-------21--1------231-----1-1----------------------------1---11------1------1111------1-2--1-14--11-----1--11--------1--------1---1-1------1----------1-2--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 196 STR:RPRED 41.8 SQ:SECSTR ######################################################################################################################################################################################################TTccccTTTEEEcccccccccccccEEEEcH#HHHTTTcTHHHHHHHHH##########HHHHcccccccccHHHHHHHHHHHHHHTTcHHHHHHHHHHHHTTcccccHHHHHHHHHHHHccccccccccccHHHHHTTccccccccccccHHHHHHHHHTTcEEEEccccccccccTTccEEEEEEEETTcccccEEEEccccHHH################################################################ DISOP:02AL 468-469| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //