[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82254.1
DDBJ      :             NADH-quinone oxidoreductase chain I
Swiss-Prot:NQO9_THET8   RecName: Full=NADH-quinone oxidoreductase subunit 9;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit 9;AltName: Full=NDH-1 subunit 9;

Homologs  Archaea  43/68 : Bacteria  584/915 : Eukaryota  155/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:182 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->179 2fug9 PDBj 3e-83 100.0 %
:RPS:PDB   12->137 1d0cB PDBj 1e-13 8.9 %
:RPS:SCOP  26->179 2fug91  d.58.1.5 * 6e-39 91.6 %
:HMM:SCOP  26->179 2fug91 d.58.1.5 * 2.8e-36 28.6 %
:HMM:PFM   51->69 PF00037 * Fer4 1.1e-08 57.9 19/24  
:HMM:PFM   91->113 PF00037 * Fer4 3.6e-12 52.2 23/24  
:BLT:SWISS 1->182 NQO9_THET8 1e-98 100.0 %
:PROS 53->64|PS00198|4FE4S_FER_1
:PROS 98->109|PS00198|4FE4S_FER_1
:REPEAT 2|27->68|77->113
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82254.1 GT:GENE AAS82254.1 GT:PRODUCT NADH-quinone oxidoreductase chain I GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1820400..1820948) GB:FROM 1820400 GB:TO 1820948 GB:DIRECTION - GB:PRODUCT NADH-quinone oxidoreductase chain I GB:PROTEIN_ID AAS82254.1 GB:DB_XREF GI:46197842 LENGTH 182 SQ:AASEQ MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVGYVVPYVRPELEGFKAPTEGGKR GT:EXON 1|1-182:0| SW:ID NQO9_THET8 SW:DE RecName: Full=NADH-quinone oxidoreductase subunit 9; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit 9;AltName: Full=NDH-1 subunit 9; SW:GN Name=nqo9; OrderedLocusNames=TTHA0092; SW:KW 3D-structure; 4Fe-4S; Cell membrane; Complete proteome; Iron;Iron-sulfur; Membrane; Metal-binding; NAD; Oxidoreductase; Quinone;Repeat. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->182|NQO9_THET8|1e-98|100.0|182/182| GO:SWS:NREP 8 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| PROS 53->64|PS00198|4FE4S_FER_1|PDOC00176| PROS 98->109|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|27->68|77->113| SEG 154->166|gkpvkvgyvvpyv| BL:PDB:NREP 1 BL:PDB:REP 26->179|2fug9|3e-83|100.0|154/154| RP:PDB:NREP 1 RP:PDB:REP 12->137|1d0cB|1e-13|8.9|123/414| HM:PFM:NREP 2 HM:PFM:REP 51->69|PF00037|1.1e-08|57.9|19/24|Fer4| HM:PFM:REP 91->113|PF00037|3.6e-12|52.2|23/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 26->179|2fug91|6e-39|91.6|154/154|d.58.1.5| HM:SCP:REP 26->179|2fug91|2.8e-36|28.6|154/0|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 992 OP:NHOMOORG 782 OP:PATTERN --3-21111111111-1--1111-11111211-----------1----11111-32242221111--1 12212---------11211-11--11111111111111111111-1--1-----------22111112221-----------1222221111----1--1-11--22211--------------111111-1112-111111112111111111111111111111111-111111111111111111--1-1-111111111111111------1-1111----------11----------------------------------------------------------------------------------------------1--------------------1--2--1-1111----12--11---23-111111111111111112322211111111111-11111111111111112221112211111111222211111111111222-11121111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111121111---1---11---1-222122215223212-2121211111111111111111211111221---------------------1----11--211111111122222212222222223-2323222323222332332222211122222222222222222233211231-21111111111111111111111111--1-----1----------11111111111-1111111111111-1111111111111--------------11111111111111111-111111------------------------------------11111-----121 ----111-----1111111-1111111111111111111111111111111111-1111111111----1--111------11111---1211111111111-112-12-215232-111-11-111112B1-3131-1-31112111--1--111111--11111111-1111-1111G11-1122241211121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 92.3 SQ:SECSTR ###########HHHHHHHHHHHHHHTTcTTcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHTcTTGGGTTcccEEEEccccccHHHHHHHHHHHHHHHHHHGGGccccEEEEcccccTTccccEEccccccTTccccHHHHHHHHHHcccccccEEccccccTTTTccccTTc### DISOP:02AL 178-182| PSIPRED ccHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEcccccccccccccccHHHHcccccEEEEEcccccccccccccccccEEEEEccccccccccHHHcccccEEEccccccccccHHHHHccHHHHcccccccccccccHHHHcccEEcccccccccccccccccccccccc //