[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82258.1
DDBJ      :             NADH-quinone oxidoreductase chain E
Swiss-Prot:NQO2_THET8   RecName: Full=NADH-quinone oxidoreductase subunit 2;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I chain 2;AltName: Full=NDH-1 subunit 2;

Homologs  Archaea  5/68 : Bacteria  541/915 : Eukaryota  171/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:181 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->180 3iam2 PDBj 3e-94 100.0 %
:RPS:PDB   74->141 2auvA PDBj 1e-18 39.7 %
:RPS:SCOP  3->180 2fug21  c.47.1.21 * 6e-43 89.9 %
:HMM:SCOP  3->170 2fug21 c.47.1.21 * 3.3e-51 44.0 %
:RPS:PFM   13->146 PF01257 * Complex1_24kDa 8e-31 49.6 %
:HMM:PFM   12->157 PF01257 * Complex1_24kDa 8.4e-53 49.7 143/145  
:BLT:SWISS 1->181 NQO2_THET8 8e-95 100.0 %
:PROS 114->132|PS01099|COMPLEX1_24K
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82258.1 GT:GENE AAS82258.1 GT:PRODUCT NADH-quinone oxidoreductase chain E GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1825705..1826250) GB:FROM 1825705 GB:TO 1826250 GB:DIRECTION - GB:PRODUCT NADH-quinone oxidoreductase chain E GB:PROTEIN_ID AAS82258.1 GB:DB_XREF GI:46197846 LENGTH 181 SQ:AASEQ MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVEV GT:EXON 1|1-181:0| SW:ID NQO2_THET8 SW:DE RecName: Full=NADH-quinone oxidoreductase subunit 2; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I chain 2;AltName: Full=NDH-1 subunit 2; SW:GN Name=nqo2; OrderedLocusNames=TTHA0088; SW:KW 2Fe-2S; 3D-structure; Cell membrane; Complete proteome;Direct protein sequencing; Disulfide bond; Iron; Iron-sulfur;Membrane; Metal-binding; NAD; Oxidoreductase; Quinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->181|NQO2_THET8|8e-95|100.0|181/181| GO:SWS:NREP 8 GO:SWS GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|2Fe-2S| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| PROS 114->132|PS01099|COMPLEX1_24K|PDOC00843| SEG 147->164|rarleallaglragkrle| BL:PDB:NREP 1 BL:PDB:REP 2->180|3iam2|3e-94|100.0|179/179| RP:PDB:NREP 1 RP:PDB:REP 74->141|2auvA|1e-18|39.7|68/85| RP:PFM:NREP 1 RP:PFM:REP 13->146|PF01257|8e-31|49.6|131/142|Complex1_24kDa| HM:PFM:NREP 1 HM:PFM:REP 12->157|PF01257|8.4e-53|49.7|143/145|Complex1_24kDa| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01257|IPR002023| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01257|IPR002023| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01257|IPR002023| RP:SCP:NREP 1 RP:SCP:REP 3->180|2fug21|6e-43|89.9|178/178|c.47.1.21| HM:SCP:REP 3->170|2fug21|3.3e-51|44.0|168/0|c.47.1.21|1/1|Thioredoxin-like| OP:NHOMO 979 OP:NHOMOORG 717 OP:PATTERN -----------------------------1----1------------1----------1-1------- 11211---------11111-11--12111111111111111111-1--1-----------11111111211----------1-11111--11-1-----1-11--21111--------------1-----1---1-22222444111111111--11------11--11--------------11111331--------------------------------------------------------------1---------------------------------------------------------------------144-1111111111121------2-2112--23113436331211121--3--111111111221111112322311111111111-22222222121122223332223322111222333322311111111322-22111111111111111111111111111111111111-22212111111222221111222222112223311111321112112222221222111111111113122131-2-1--3-----343243265111111641--1---------------------11112---2-----------------1----21--211111111111111111111111111-1111111111111111111111111111111111111111111111111111-1111111-1-1111111111111114-111---------------11111111111-1111121122222-1111111111111--------------11111111111111111-111111------------------------------------3223333233221 ----111-211-11111111111111-111111111111111111111111111111111-1111----1--111------111111--12111111111111112-111211111111111111113-3A1-3121-111113111-111111-11111111111221251111111171111121321111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 98.9 SQ:SECSTR #ccccTTHHHHHHHHTTccTTcGGGGHHHHHHHHHHHHccccHHHHHHHHHHHTccHHHHHHHHTTcccccccccccccEEccccHHHHTTTHHHHHHHHHHHHccccccccccccccccccccccccTTccccEEGGGccEEcccHHHHHHHHHHHHHTccGGGccccccccccccccc# DISOP:02AL 160-181| PSIPRED ccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEccccccccccEEEEccEEEEEEccHHHHHHHHHHHHccccccccccccccccEEEcccc //