[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82267.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:44 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->38 PF06525 * SoxE 0.00022 35.3 34/195  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82267.1 GT:GENE AAS82267.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1831953..1832087) GB:FROM 1831953 GB:TO 1832087 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS82267.1 GB:DB_XREF GI:46197855 LENGTH 44 SQ:AASEQ MPGPNDYPLYYDSSNSKVLSAVATIDTTPLPLNYVGPQQVPLTP GT:EXON 1|1-44:0| HM:PFM:NREP 1 HM:PFM:REP 4->38|PF06525|0.00022|35.3|34/195|SoxE| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 43-44| PSIPRED ccccccccEEEcccccEEEEEEEccccccccccccccccccccc //