[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82268.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   3->29 1zpwX PDBj 7e-05 63.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82268.1 GT:GENE AAS82268.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1832204..1832440 GB:FROM 1832204 GB:TO 1832440 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS82268.1 GB:DB_XREF GI:46197856 LENGTH 78 SQ:AASEQ MEKRLSAVASDFPDHLRQVKPTHLLKTYGFGFAGPLGDLRRRARRLLDLGPNALSIGLDPDRPPCPAQARHGLLSPGF GT:EXON 1|1-78:0| SEG 33->51|agplgdlrrrarrlldlgp| BL:PDB:NREP 1 BL:PDB:REP 3->29|1zpwX|7e-05|63.0|27/82| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 77-78| PSIPRED ccHHHHHHHHHHHHHHHHccHHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEccccccccccHHHHcccccccc //