[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82281.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   38->89 PF04290 * DctQ 0.00024 32.7 52/133  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82281.1 GT:GENE AAS82281.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1847670..1848029) GB:FROM 1847670 GB:TO 1848029 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS82281.1 GB:DB_XREF GI:46197869 LENGTH 119 SQ:AASEQ MDFPEGPRVSFRGKEVHMNAKEFFAALFDLAFERFVTIQLTGLVYALALAVGGIYALFAVVGAFEASAGLGVLTLLVLAPLGFLLYAVAVRVGLEALVSLIRIAENTREIRDALRKEKA GT:EXON 1|1-119:0| TM:NTM 2 TM:REGION 32->54| TM:REGION 77->99| SEG 20->33|akeffaalfdlafe| SEG 68->85|aglgvltllvlaplgfll| HM:PFM:NREP 1 HM:PFM:REP 38->89|PF04290|0.00024|32.7|52/133|DctQ| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 116-119| PSIPRED ccccccccccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //