[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82286.1
DDBJ      :             alanine racemase
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  774/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.49.2c.1.6
:361 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->359 3e5pB PDBj 1e-39 34.4 %
:RPS:PDB   15->359 3e5pB PDBj 9e-41 31.6 %
:RPS:SCOP  19->243 1bd0A2  c.1.6.1 * 1e-26 33.2 %
:RPS:SCOP  233->361 1bd0A1  b.49.2.2 * 1e-22 33.6 %
:HMM:SCOP  19->237 1rcqA2 c.1.6.1 * 1.5e-54 44.9 %
:HMM:SCOP  225->360 1bd0A1 b.49.2.2 * 4.8e-38 40.7 %
:RPS:PFM   19->226 PF01168 * Ala_racemase_N 3e-10 40.1 %
:RPS:PFM   269->360 PF00842 * Ala_racemase_C 4e-06 48.2 %
:HMM:PFM   19->228 PF01168 * Ala_racemase_N 3.4e-52 43.1 204/214  
:HMM:PFM   238->359 PF00842 * Ala_racemase_C 1.3e-26 37.7 122/129  
:BLT:SWISS 19->360 ALR_LACF3 2e-44 38.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82286.1 GT:GENE AAS82286.1 GT:PRODUCT alanine racemase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1852562..1853647 GB:FROM 1852562 GB:TO 1853647 GB:DIRECTION + GB:PRODUCT alanine racemase GB:PROTEIN_ID AAS82286.1 GB:DB_XREF GI:46197874 LENGTH 361 SQ:AASEQ MPAGPIGLVEVEERAWVEVDLAALWANYRLLAGRAGGEVIPVLKADAYGHGALPLARFLEGKGVGRFAVATLEEGRRLREGGIKGEVLLLGSLHPLEAEEALELGLVPTLSTLEAAEALSQRARALGLVPRAHLKVDTGMNRVGFPWEEAASALRAVEALGVRVEGVYTHLATAGEDAAFVETQRRRFQEVRRALGEGYFYHLENSLGLLRHGATAGVRVGLALYGLVPGFGLRPILRILARPTLVKRLKAGDRVGYGGVYVARGGEWLATLPVGYADGLPWGAVRFVKGPDGRLLEVAGRISMDQTTVLLPGPVGLEAVFEVLSADFGPTGLLAWAEARGTLPYEVAVHLSRRLPRRYLE GT:EXON 1|1-361:0| BL:SWS:NREP 1 BL:SWS:REP 19->360|ALR_LACF3|2e-44|38.7|341/373| SEG 96->106|leaeealelgl| SEG 251->266|agdrvgyggvyvargg| BL:PDB:NREP 1 BL:PDB:REP 17->359|3e5pB|1e-39|34.4|343/371| RP:PDB:NREP 1 RP:PDB:REP 15->359|3e5pB|9e-41|31.6|345/371| RP:PFM:NREP 2 RP:PFM:REP 19->226|PF01168|3e-10|40.1|197/211|Ala_racemase_N| RP:PFM:REP 269->360|PF00842|4e-06|48.2|83/127|Ala_racemase_C| HM:PFM:NREP 2 HM:PFM:REP 19->228|PF01168|3.4e-52|43.1|204/214|Ala_racemase_N| HM:PFM:REP 238->359|PF00842|1.3e-26|37.7|122/129|Ala_racemase_C| GO:PFM:NREP 2 GO:PFM GO:0006522|"GO:alanine metabolic process"|PF00842|IPR011079| GO:PFM GO:0008784|"GO:alanine racemase activity"|PF00842|IPR011079| RP:SCP:NREP 2 RP:SCP:REP 19->243|1bd0A2|1e-26|33.2|223/233|c.1.6.1| RP:SCP:REP 233->361|1bd0A1|1e-22|33.6|122/148|b.49.2.2| HM:SCP:REP 19->237|1rcqA2|1.5e-54|44.9|214/0|c.1.6.1|1/1|PLP-binding barrel| HM:SCP:REP 225->360|1bd0A1|4.8e-38|40.7|135/149|b.49.2.2|1/1|Alanine racemase C-terminal domain-like| OP:NHOMO 913 OP:NHOMOORG 783 OP:PATTERN --------------------------------------11111------------------------- -1111111111--111111-11111111111111111111111111111222212112--11211-111111111111111111111111111111---11111111111--------------11111111111111111---111111111111111111111111111111111111111111111111122222222222222221122222231111222111111321111111111111111111111111111111111111111232111111111111111111111111111111111111111111111111112233322331211211122211111111212211121112112112111-11111-1112-1111111112111111111111-11-1111222112223112112112--2111-111111-11111111-222111-------------111111-11-111-----112-11---1111112211111111111111112-211-111111-11111111-1111111111111111111111111111111211111111111111111-111111-111111-1-111111111111--33111-111-21111111-1111111111---11111------12111111112112111-1111111111111111113222---1212221121111212212---11111-211111111111--1111111----1-111---111111111111111111----11222211112222111111111111111111311111-311111111111111111--11111111111-11-111--------------------------11111-----112 -------------------------------------------------------------------------------------------------------------1-----------------------------------------------------31-----------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 354 STR:RPRED 98.1 SQ:SECSTR #######ccccccccEEEEcHHHHHHHHHHHHTTccTTcEEEcHHHHHTTcHHHHHHHHHHTTccEEEEccHHHHHHHHHTTccccEEEcccccGGGHHHHHHTTcEEEEcHHHHHHHHHHHTTcccccEEEEEEccTTcccccccccHHHHHHHHHTcTTEEEEEEEcccccTTcccHHHHHHHHHHHHHHTTcccccEEEEEcHHHHHHcTTccEEEEcGGGGTccTcccccccEEEEEEccEEEEEcTTcEEcGGGcEEccccEEEEEEcccTTTTccGGGTTcEEEETTEEEEEEcccccccEEEEEccccccccEEEEEEEETTEEEcHHHHHHHTccHHHHHHHccTTccEEEEE DISOP:02AL 1-7| PSIPRED cccccccccccccccEEEEEHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHccccEEEEEEHHHHHHHHHccccccEEEEccccHHHHHHHHHcccEEEEccHHHHHHHHHHHHHccccEEEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHcccccccccEEEEEccccccccEEEEEEEEEEEEEEEEccccccccccEEEEccccEEEEEEEEcccccHHccccccEEEccEEEEEEccEEEcEEEEEcccccccccEEEEEEcccccccHHHHHHHHcccccEEEEcccccccEEEEc //