[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82289.1
DDBJ      :             molybdopterin (MPT) converting factor, subunit 2
Swiss-Prot:             

Homologs  Archaea  54/68 : Bacteria  493/915 : Eukaryota  139/199 : Viruses  0/175   --->[See Alignment]
d.15.3d.41.5
:223 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->79 1jwbD PDBj 1e-11 48.7 %
:BLT:PDB   88->212 2qieA PDBj 2e-25 41.6 %
:RPS:PDB   3->78 3biiD PDBj 3e-15 37.3 %
:RPS:SCOP  1->76 1vjkA  d.15.3.1 * 2e-17 36.8 %
:RPS:SCOP  85->214 1fm0E  d.41.5.1 * 6e-33 42.3 %
:HMM:SCOP  2->79 1fm0D_ d.15.3.1 * 6.8e-21 53.2 %
:HMM:SCOP  79->215 1fm0E_ d.41.5.1 * 1.2e-50 50.4 %
:RPS:PFM   8->79 PF02597 * ThiS 5e-09 58.6 %
:RPS:PFM   88->195 PF02391 * MoaE 2e-25 51.9 %
:HMM:PFM   85->196 PF02391 * MoaE 2.8e-40 48.2 112/117  
:HMM:PFM   5->79 PF02597 * ThiS 7.6e-20 52.1 73/78  
:BLT:SWISS 3->79 MOAD_ECOLI 4e-11 48.7 %
:BLT:SWISS 102->213 MOAE_BACHD 5e-31 46.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82289.1 GT:GENE AAS82289.1 GT:PRODUCT molybdopterin (MPT) converting factor, subunit 2 GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1854274..1854945) GB:FROM 1854274 GB:TO 1854945 GB:DIRECTION - GB:PRODUCT molybdopterin (MPT) converting factor, subunit 2 GB:PROTEIN_ID AAS82289.1 GB:DB_XREF GI:46197877 LENGTH 223 SQ:AASEQ MRIEVRLFALYREQAGTDRLALELPEGARVREAQKALEERFPGLRLEGGMAAVNQALAGAETPLKEGDEVAFLPPVSGGQDSYGLTQEPLDLEALVAWATAPEYGAVVSFLGTTRSPNRGEEVAFLEYEAYPEMAEKVMAEILAEMRARWPLGRIALWHRLGRVDPGEASIAIVVSARHRKEAFAACQYAIDRVKQILPVWKKEHRKDGSFWVEGFAPEDKRL GT:EXON 1|1-223:0| BL:SWS:NREP 2 BL:SWS:REP 3->79|MOAD_ECOLI|4e-11|48.7|76/81| BL:SWS:REP 102->213|MOAE_BACHD|5e-31|46.4|112/156| BL:PDB:NREP 2 BL:PDB:REP 3->79|1jwbD|1e-11|48.7|76/80| BL:PDB:REP 88->212|2qieA|2e-25|41.6|125/136| RP:PDB:NREP 1 RP:PDB:REP 3->78|3biiD|3e-15|37.3|75/80| RP:PFM:NREP 2 RP:PFM:REP 8->79|PF02597|5e-09|58.6|70/79|ThiS| RP:PFM:REP 88->195|PF02391|2e-25|51.9|108/117|MoaE| HM:PFM:NREP 2 HM:PFM:REP 85->196|PF02391|2.8e-40|48.2|112/117|MoaE| HM:PFM:REP 5->79|PF02597|7.6e-20|52.1|73/78|ThiS| GO:PFM:NREP 2 GO:PFM GO:0006790|"GO:sulfur metabolic process"|PF02597|IPR003749| GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF02391|IPR003448| RP:SCP:NREP 2 RP:SCP:REP 1->76|1vjkA|2e-17|36.8|76/87|d.15.3.1| RP:SCP:REP 85->214|1fm0E|6e-33|42.3|123/142|d.41.5.1| HM:SCP:REP 2->79|1fm0D_|6.8e-21|53.2|77/0|d.15.3.1|1/1|MoaD/ThiS| HM:SCP:REP 79->215|1fm0E_|1.2e-50|50.4|137/149|d.41.5.1|1/1|Molybdopterin synthase subunit MoaE| OP:NHOMO 808 OP:NHOMOORG 686 OP:PATTERN 1111-211111111111-1111111--11111------111111111211111-11112111112--- 111-11--11-1-11--11-1-----22222-----11--1--1--12111-1111-1---1111111111-----------111111---------------11111----------------------1---1111111---1121121111111-----211121111------------11111---1-13333332313333331111113322111--11111111111111111111111111111-------1---11-1-----------------------------------------------------------------------------------1------------------1--1-11111-----111111111111111111111111-11111111111-1111111111111112-11--1--11111111111-1111111-----------------------------1---1-1111122212211111221111111121111111111111111111111111111111----------111------------------------111111---------------------------111112111-1-11111111111111111111----1-1------21211112221211112-222221121121222222211111111111111111111111112212222--211111111111---1---------2111111111111111111111111-11111111111221111111111---------1111111111111111111111111----111-11--------------------------------------------------11- ----111-----12111111111211-111111111111111111111111-11-1111111-----------1---------------11111-1------111--12---111121--11112212-321-12291113-1111111111-1111111111211-11211121-11171-11111-21111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 215 STR:RPRED 96.4 SQ:SECSTR EEEEEEEcHHHHHHHcccEEEEcccccccHHHHHHHHHTTcHHHHcTTcEEEETTEEccTTccccTTcEEEEEcccccccccccHHHcccccHHHHHHHccTTccEEEEEEEEcccEETTEEccEEEEEEcHHHHHHHHHHHHHHHHHHcTTcEEEEEEEcEEEcTTcEEEEEEEEEccHHHHHHHHHHHHHHHHHHccEEEEEEccccEEEEEc######## DISOP:02AL 218-223| PSIPRED cEEEEEEEEHHHHHHcccEEEEEccccccHHHHHHHHHHHccccccccEEEEEcccccccccccccccEEEEEcccccccEEEEEEEccccHHHHHHHHHcccccEEEEEEEEEEEcccccEEEEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHccEEEEEEEccccEEEcccccHHHcc //