[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82309.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:185 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->183 1pv7A_ f.38.1.2 * 1.5e-14 35.5 %
:HMM:PFM   17->178 PF07690 * MFS_1 6.5e-13 33.5 161/353  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82309.1 GT:GENE AAS82309.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1871089..1871646) GB:FROM 1871089 GB:TO 1871646 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS82309.1 GB:DB_XREF GI:46197897 LENGTH 185 SQ:AASEQ MRFLWESPSLRPLLLQEALLGLAYAFFAGLLPFVVLRGLGEASWVLGLLGAVQSLGGALGGLLVGAVLGRLGEGGTLRLALGLAGLGLLGVVFLPPWPLLAGSAFLLGAGGALFGAVAGAVRLSQAPPELRSRVAGGFLFLSGALAPLGPLLGGALAGVALPLPFLLAGGLLLGFAALLGRRRAA GT:EXON 1|1-185:0| TM:NTM 5 TM:REGION 16->38| TM:REGION 45->67| TM:REGION 74->96| TM:REGION 133->155| TM:REGION 159->180| SEG 10->31|lrplllqeallglayaffagll| SEG 45->90|vlgllgavqslggalggllvgavlgrlgeggtlrlalglaglgllg| SEG 99->123|llagsafllgaggalfgavagavrl| SEG 135->184|aggflflsgalaplgpllggalagvalplpfllagglllgfaallgrrra| HM:PFM:NREP 1 HM:PFM:REP 17->178|PF07690|6.5e-13|33.5|161/353|MFS_1| HM:SCP:REP 1->183|1pv7A_|1.5e-14|35.5|183/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 5-7, 184-185| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHHHHHHcccHHHHccHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //