[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82312.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:69 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   36->53 PF09360 * zf-CDGSH 3e-04 77.8 %
:HMM:PFM   7->53 PF09360 * zf-CDGSH 5.5e-21 67.6 37/38  
:BLT:SWISS 23->68 MURB_RUBXD 2e-04 43.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82312.1 GT:GENE AAS82312.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1874674..1874883) GB:FROM 1874674 GB:TO 1874883 GB:DIRECTION - GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS82312.1 GB:DB_XREF GI:46197900 LENGTH 69 SQ:AASEQ MRLEFLENGPIRVEGKRFVVRVGEKEEVLERPRVFLCRCGGSGNKPFCDGTHKRIGFQAPGGVLEVEGD GT:EXON 1|1-69:0| BL:SWS:NREP 1 BL:SWS:REP 23->68|MURB_RUBXD|2e-04|43.5|46/297| RP:PFM:NREP 1 RP:PFM:REP 36->53|PF09360|3e-04|77.8|18/35|zf-CDGSH| HM:PFM:NREP 1 HM:PFM:REP 7->53|PF09360|5.5e-21|67.6|37/38|zf-CDGSH| GO:PFM:NREP 2 GO:PFM GO:0043231|"GO:intracellular membrane-bounded organelle"|PF09360|IPR018967| GO:PFM GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|PF09360|IPR018967| OP:NHOMO 14 OP:NHOMOORG 12 OP:PATTERN ---------------------------------------------------1---------------- 111----------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------22---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------1--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 62-69| PSIPRED cEEEEEccccEEEcccEEEEccccEEEEccccEEEEEEccccccccEEccccccccEEccccEEEEccc //