[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82321.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.269.1
:123 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->64 1xhsA PDBj 3e-04 47.1 %
:RPS:PDB   4->98 3cryA PDBj 1e-06 17.9 %
:RPS:SCOP  4->97 1xhsA  d.269.1.1 * 2e-10 25.6 %
:HMM:SCOP  1->124 1vkbA_ d.269.1.1 * 4e-25 40.3 %
:RPS:PFM   4->102 PF06094 * AIG2 1e-05 44.6 %
:HMM:PFM   4->106 PF06094 * AIG2 6.1e-26 45.9 98/104  
:BLT:SWISS 4->64 Y2546_VIBCH 3e-05 54.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82321.1 GT:GENE AAS82321.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1883705..1884076 GB:FROM 1883705 GB:TO 1884076 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS82321.1 GB:DB_XREF GI:46197909 LENGTH 123 SQ:AASEQ MEAVFVYGTLKRGERNHGLVAPYLHRVLPGFVEGFRLYHLPRGPHRPYAYPGMVPGEGRVFGEVLFLRPEALSLLDALEEEGEEYKRVRVRVETEEGPLEAWAYLYLGGLEGALPLPQGVWKG GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 4->64|Y2546_VIBCH|3e-05|54.9|51/115| SEG 70->84|ealslldaleeegee| SEG 103->117|aylylgglegalplp| BL:PDB:NREP 1 BL:PDB:REP 4->64|1xhsA|3e-04|47.1|51/113| RP:PDB:NREP 1 RP:PDB:REP 4->98|3cryA|1e-06|17.9|95/169| RP:PFM:NREP 1 RP:PFM:REP 4->102|PF06094|1e-05|44.6|92/103|AIG2| HM:PFM:NREP 1 HM:PFM:REP 4->106|PF06094|6.1e-26|45.9|98/104|AIG2| RP:SCP:NREP 1 RP:SCP:REP 4->97|1xhsA|2e-10|25.6|86/113|d.269.1.1| HM:SCP:REP 1->124|1vkbA_|4e-25|40.3|119/151|d.269.1.1|1/1|BtrG-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 98 STR:RPRED 79.7 SQ:SECSTR cEEEEEccGGGcHHHHHHHcTTcEEEEEEEEEEEEEEETTcccTTTcccEEEEEEEEEEEEEEEEEEEEGHHHHHHHTTGGGTccEEEEEEEEETTcc######################### PSIPRED cccEEEEEEcccccccHHHHHccccccccEEEEcEEEEEccccccccccccEEEccccEEEEEEEEEcHHHHHHHHHHccccccEEEEEEEEEEccEEEEEEEEEccccccccEEccccEEcc //