[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82326.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:198 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82326.1 GT:GENE AAS82326.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1887975..1888571) GB:FROM 1887975 GB:TO 1888571 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS82326.1 GB:DB_XREF GI:46197914 LENGTH 198 SQ:AASEQ MEGVEAFLFFLALRGEAKREEVRARFPRLVPLLKALGEAVEVQGETFRLAKPLRLSWFAPLFRARYSPLLPEEERALALERLVEAAFRSAEAGEPLVDGEGLLKAARLFQAGSQALLKGDHREALHRLGEALGLLEKEGLPFPAAALALLAQAQEGFRPGGKGKATARKALRRAQTPFVREVAERILSPATDPEAPGP GT:EXON 1|1-198:0| SEG 68->86|pllpeeeralalerlveaa| SEG 128->157|lgealgllekeglpfpaaalallaqaqegf| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 156-165, 191-198| PSIPRED ccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccHHHHHHHHHHHccccccccccc //