[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82327.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->42 PF10957 * DUF2758 6.2e-06 48.0 25/60  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82327.1 GT:GENE AAS82327.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1888559..1888750) GB:FROM 1888559 GB:TO 1888750 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS82327.1 GB:DB_XREF GI:46197915 LENGTH 63 SQ:AASEQ MQGVRFRVITANDPDILQERLNRFVEGLPEDVVLVDVKFAVAEGPSPLFAVLVQYKEVEAWKG GT:EXON 1|1-63:0| HM:PFM:NREP 1 HM:PFM:REP 17->42|PF10957|6.2e-06|48.0|25/60|DUF2758| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccEEEEEEcccHHHHHHHHHHHHHcccccEEEEEEEEEEcccccHHHHHHHHHHHHccccc //