[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : asnC
DDBJ      :asnC         transcriptional regulatory protein, asnC family
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  53/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:92 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->80 2djwA PDBj 2e-39 97.5 %
:RPS:PDB   1->79 2djwH PDBj 2e-19 97.5 %
:RPS:SCOP  2->78 1i1gA2  d.58.4.2 * 5e-17 19.5 %
:HMM:SCOP  1->81 2cg4A2 d.58.4.2 * 9.1e-18 39.5 %
:RPS:PFM   15->71 PF01037 * AsnC_trans_reg 4e-08 45.6 %
:HMM:PFM   6->76 PF01037 * AsnC_trans_reg 2.9e-22 40.8 71/74  
:BLT:SWISS 2->78 REG6_PYRFU 5e-11 34.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80841.1 GT:GENE asnC GT:PRODUCT transcriptional regulatory protein, asnC family GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(481852..482130) GB:FROM 481852 GB:TO 482130 GB:DIRECTION - GB:GENE asnC GB:PRODUCT transcriptional regulatory protein, asnC family GB:PROTEIN_ID AAS80841.1 GB:DB_XREF GI:46196424 GB:GENE:GENE asnC LENGTH 92 SQ:AASEQ MITAFVLIRARGNRVQALGEAIAELPQVGEVYSVTGPYDLVALVRLKDVEELDDVVTQGILSLEGVERTETLLAFRAYPRRLLDQGFALGQG GT:EXON 1|1-92:0| BL:SWS:NREP 1 BL:SWS:REP 2->78|REG6_PYRFU|5e-11|34.2|76/151| BL:PDB:NREP 1 BL:PDB:REP 1->80|2djwA|2e-39|97.5|80/80| RP:PDB:NREP 1 RP:PDB:REP 1->79|2djwH|2e-19|97.5|79/79| RP:PFM:NREP 1 RP:PFM:REP 15->71|PF01037|4e-08|45.6|57/74|AsnC_trans_reg| HM:PFM:NREP 1 HM:PFM:REP 6->76|PF01037|2.9e-22|40.8|71/74|AsnC_trans_reg| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01037|IPR019887| GO:PFM GO:0005622|"GO:intracellular"|PF01037|IPR019887| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01037|IPR019887| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01037|IPR019887| RP:SCP:NREP 1 RP:SCP:REP 2->78|1i1gA2|5e-17|19.5|77/80|d.58.4.2| HM:SCP:REP 1->81|2cg4A2|9.1e-18|39.5|81/0|d.58.4.2|1/1|Dimeric alpha+beta barrel| OP:NHOMO 58 OP:NHOMOORG 57 OP:PATTERN -----1-----------------1-------------------------------1-1---------- ----1-------------------------------11111---11111---111111--111-1211111-111-------1-------------------------1---------------------------11111---1--------------------------------------11111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1111--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 91.3 SQ:SECSTR cEEEEEEEEEcTTTHHHHHHHHHTcTTEEEEEEccccccEEEEEEEcccTTHHHHTTTTGGGcTTEEEEEEEEccccccccccc######## DISOP:02AL 91-92| PSIPRED cEEEEEEEEEcccHHHHHHHHHHcccHHEEHHHccccccEEEEEEEccHHHHHHHHHHHHHccccccEEHHHHHEEHHcccccccccccccc //