[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : ccdA
DDBJ      :ccdA         cytochrome C-type biogenesis protein ccdA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:222 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->34,124->178 PF02683 * DsbD 8e-08 54.5 %
:HMM:PFM   8->200 PF02683 * DsbD 4.4e-47 43.5 193/211  
:BLT:SWISS 9->34,124->175 CCDA_BACSU 1e-10 49.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81386.1 GT:GENE ccdA GT:PRODUCT cytochrome C-type biogenesis protein ccdA GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1017170..1017838) GB:FROM 1017170 GB:TO 1017838 GB:DIRECTION - GB:GENE ccdA GB:PRODUCT cytochrome C-type biogenesis protein ccdA GB:PROTEIN_ID AAS81386.1 GB:DB_XREF GI:46196971 GB:GENE:GENE ccdA LENGTH 222 SQ:AASEQ MSLSLTAAFLAGVLSFLSPCVLPLVPTYLFYLGGERGRPLFNALFFILGFGAVFFLLGLPFTLLGGLLFEHRQTLARVGGVVLVLFGLYMLGLRPRWGVSLRYEGETSRPLGAFLLGATLALGWTPCIGPILGAILTLTAVGGGVGFLLAYILGLAVPFFVVALFADRIKGWLRRAGRISHYVEVLAGVVLVLVGVLLFTGTFTALNTFFLRITPEWLQRYL GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 9->34,124->175|CCDA_BACSU|1e-10|49.0|77/235| TM:NTM 6 TM:REGION 7->29| TM:REGION 44->66| TM:REGION 70->91| TM:REGION 112->134| TM:REGION 145->167| TM:REGION 187->209| SEG 44->69|lffilgfgavffllglpftllggllf| SEG 78->93|vggvvlvlfglymlgl| SEG 111->123|lgafllgatlalg| SEG 183->198|vevlagvvlvlvgvll| RP:PFM:NREP 1 RP:PFM:REP 8->34,124->178|PF02683|8e-08|54.5|82/209|DsbD| HM:PFM:NREP 1 HM:PFM:REP 8->200|PF02683|4.4e-47|43.5|193/211|DsbD| GO:PFM:NREP 3 GO:PFM GO:0016020|"GO:membrane"|PF02683|IPR003834| GO:PFM GO:0017004|"GO:cytochrome complex assembly"|PF02683|IPR003834| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02683|IPR003834| OP:NHOMO 17 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------1---------1----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-2---1---11-111-------2------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 96-112| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHc //