[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : ccmE
DDBJ      :ccmE         cytochrome C-type biogenesis protein ccmE
Swiss-Prot:CCME_THET2   RecName: Full=Cytochrome c-type biogenesis protein ccmE;AltName: Full=Cytochrome c maturation protein E;AltName: Full=Heme chaperone ccmE;

Homologs  Archaea  0/68 : Bacteria  331/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
b.40.9
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->126 1lizA PDBj 2e-17 40.8 %
:RPS:SCOP  27->118 1j6qA  b.40.9.1 * 1e-12 34.8 %
:HMM:SCOP  24->126 1sr3A_ b.40.9.1 * 4.5e-33 49.5 %
:RPS:PFM   19->126 PF03100 * CcmE 4e-25 51.4 %
:HMM:PFM   7->126 PF03100 * CcmE 7.7e-40 43.7 119/131  
:BLT:SWISS 1->142 CCME_THET2 2e-73 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81381.1 GT:GENE ccmE GT:PRODUCT cytochrome C-type biogenesis protein ccmE GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1014630..1015058) GB:FROM 1014630 GB:TO 1015058 GB:DIRECTION - GB:GENE ccmE GB:PRODUCT cytochrome C-type biogenesis protein ccmE GB:PROTEIN_ID AAS81381.1 GB:DB_XREF GI:46196966 GB:GENE:GENE ccmE LENGTH 142 SQ:AASEQ MKGKYLLGILVILGALGYMVFGGLGRNLVYFLTPSEYLQDQARYQNRPVRLGGLVKPGTVQYDKDRLELRFVLTDGVAEVPVLHKGTPPGMFKEGQGVVVEGRFQEGVFQGTNLLVKHSETYQPPKEGWTPEEVRKLIEEAQ GT:EXON 1|1-142:0| SW:ID CCME_THET2 SW:DE RecName: Full=Cytochrome c-type biogenesis protein ccmE;AltName: Full=Cytochrome c maturation protein E;AltName: Full=Heme chaperone ccmE; SW:GN Name=ccmE; Synonyms=cycJ; OrderedLocusNames=TT_C1039; SW:KW Cell inner membrane; Cell membrane; Complete proteome;Cytochrome c-type biogenesis; Heme; Iron; Membrane; Metal-binding;Signal-anchor; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->142|CCME_THET2|2e-73|100.0|142/142| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0017004|"GO:cytochrome complex assembly"|Cytochrome c-type biogenesis| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 4->26| SEG 6->17|llgilvilgalg| BL:PDB:NREP 1 BL:PDB:REP 24->126|1lizA|2e-17|40.8|103/114| RP:PFM:NREP 1 RP:PFM:REP 19->126|PF03100|4e-25|51.4|107/131|CcmE| HM:PFM:NREP 1 HM:PFM:REP 7->126|PF03100|7.7e-40|43.7|119/131|CcmE| GO:PFM:NREP 3 GO:PFM GO:0005886|"GO:plasma membrane"|PF03100|IPR004329| GO:PFM GO:0017003|"GO:protein-heme linkage"|PF03100|IPR004329| GO:PFM GO:0017004|"GO:cytochrome complex assembly"|PF03100|IPR004329| RP:SCP:NREP 1 RP:SCP:REP 27->118|1j6qA|1e-12|34.8|92/100|b.40.9.1| HM:SCP:REP 24->126|1sr3A_|4.5e-33|49.5|103/0|b.40.9.1|1/1|Heme chaperone CcmE| OP:NHOMO 371 OP:NHOMOORG 339 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------11111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11111111111111111111111111111111--11111111111-1111--12111111111111111111211111111111111111111111111111111111111111---1111111-11-1-----------------------111221111-11----1-1---11-----1-------121111----------------------------1------------------------------11-111111111111111111111111111---111--------1--1-11111111111-111111111111111111111111---222222222222222211111111--111111111111---1-----1111111-1111111111111111-------1111111111121111111111----------1111111111111111222222231111111-------------------------------------------------------- -----------------------------------------------------------------------------------------------------------1-1-----------------------------------------------------------------1---------1112-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 73.9 SQ:SECSTR #####################TTccccccccccTTTTTcccTTTccccEEEEEEEcTTTcEEcccccEEEEEEEccccEEEEEEEccccTTccTTcEEEEEEEEcccEEEEcccccccccccccHH################ DISOP:02AL 1-2, 131-142| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHccccEEEcHHHHHcccccccccEEEEccEEEEcEEEEccccEEEEEEEEccccEEEEEEEEEcccHHHcccEEEEEEEEcccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHcc //