[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : ccmG
DDBJ      :ccmG         ccmG protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  453/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:178 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   37->173 1kngA PDBj 6e-20 40.6 %
:RPS:PDB   28->178 2b1kA PDBj 5e-26 30.5 %
:RPS:SCOP  58->178 1z5yE1  c.47.1.10 * 5e-32 31.6 %
:HMM:SCOP  1->178 1jfuA_ c.47.1.10 * 1.3e-36 37.7 %
:RPS:PFM   39->162 PF08534 * Redoxin 3e-22 46.6 %
:HMM:PFM   37->157 PF00578 * AhpC-TSA 5.3e-22 34.8 112/124  
:BLT:SWISS 24->178 CYCY_BRAJA 1e-20 40.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81379.1 GT:GENE ccmG GT:PRODUCT ccmG protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1012169..1012705) GB:FROM 1012169 GB:TO 1012705 GB:DIRECTION - GB:GENE ccmG GB:PRODUCT ccmG protein GB:PROTEIN_ID AAS81379.1 GB:DB_XREF GI:46196964 GB:GENE:GENE ccmG LENGTH 178 SQ:AASEQ MRGWLWLLVVLALGGLFWWGMQRNPKELPSVLAKERRPAPDFTLPLLPPYRAEWGEAFRLADHLGKRPIVLNFWASWCYPACYEEAPILEASWRRHREEVLFVGVNTQDKEEEALRFIAQFGLTFPQVYDPRGRVGVDYGMYGVPETFFIDREGRVLARHAGAIDEATLARYLEEALR GT:EXON 1|1-178:0| BL:SWS:NREP 1 BL:SWS:REP 24->178|CYCY_BRAJA|1e-20|40.3|149/194| TM:NTM 1 TM:REGION 4->26| SEG 3->20|gwlwllvvlalgglfwwg| BL:PDB:NREP 1 BL:PDB:REP 37->173|1kngA|6e-20|40.6|133/144| RP:PDB:NREP 1 RP:PDB:REP 28->178|2b1kA|5e-26|30.5|141/149| RP:PFM:NREP 1 RP:PFM:REP 39->162|PF08534|3e-22|46.6|116/132|Redoxin| HM:PFM:NREP 1 HM:PFM:REP 37->157|PF00578|5.3e-22|34.8|112/124|AhpC-TSA| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08534|IPR013740| RP:SCP:NREP 1 RP:SCP:REP 58->178|1z5yE1|5e-32|31.6|117/136|c.47.1.10| HM:SCP:REP 1->178|1jfuA_|1.3e-36|37.7|167/176|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 748 OP:NHOMOORG 455 OP:PATTERN -------------------------------------------------------------------- 23621--------12------4----------3123211421112111111141511-112152--11111---------111-----3313-111---1-1-2-82-12---------------11-2---1-2-3333311122-------------------------------------1122311-2323333334323343333332313342422323------332-----------------------------------------------------1111111111111-----------------------1-1-21111111111-1---111311--3--1-11-1--1--11111-2-212111111111111111111111111111111112-11111111111-1111111111111111141221221221111111111111311-----------------------------111111122-2111121-------------1-11122341111-32-322213--1232----1-------241114-----1-1-----111122211111-2-23-1---------------------1-----11-145412123332213132212211131---3334-------1----------1------------------------11112----2------------------------111111-11111---1-----111133312111222122221112-------1211422222222222223211---------12222111112222211223222231111-11----------------1-------------------------------------1- --------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 87.6 SQ:SECSTR ######################ccHHHcccTTTTccccccccEEEEcccTGcTTTcEEEGGGGcccccEEEEEEcTTcHHHHHHHHHHHHHHHHTTGGGccEEEEEEcccHHHHHHHHHHHcccccEEEETTcHHHHHHTcccccEEEEEcTTccEEEEEEccccHHHHHHTTHHHHH PSIPRED cHHHHHHHHHHHHHHHHHccccccHHHcccHHccccccccccccccccccccccccEEEHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHHHHccEEEEEEEccccHHHHHHHHHHccccccEEEcccHHHHHHcccccccEEEEEccccEEEEEEEccccHHHHHHHHHHHcc //