[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : ccmH
DDBJ      :ccmH         cytochrome C-type biogenesis protein ccmH
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  232/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->90 2hl7A PDBj 2e-13 44.1 %
:RPS:PFM   31->90 PF03918 * CcmH 2e-15 53.3 %
:HMM:PFM   21->135 PF03918 * CcmH 2.1e-38 47.0 115/148  
:BLT:SWISS 22->90 NRFF_ECO57 1e-13 44.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81378.1 GT:GENE ccmH GT:PRODUCT cytochrome C-type biogenesis protein ccmH GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1011753..1012172) GB:FROM 1011753 GB:TO 1012172 GB:DIRECTION - GB:GENE ccmH GB:PRODUCT cytochrome C-type biogenesis protein ccmH GB:PROTEIN_ID AAS81378.1 GB:DB_XREF GI:46196963 GB:GENE:GENE ccmH LENGTH 139 SQ:AASEQ MRWVVLLMAFFLPALAQEAPPPDLPPEVFRIARELRCPVCQGESAAESNSGVAVEMRRIIAEMLQEGKTEEEIKAFFVERYGEWILYAPPRRGVTLWVWVLPVLGLLLLGLGLFAYFRPKPLPKELLEEAERRLKEPPR GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 22->90|NRFF_ECO57|1e-13|44.9|69/127| TM:NTM 2 TM:REGION 1->23| TM:REGION 95->117| SEG 93->113|gvtlwvwvlpvlgllllglgl| SEG 118->138|rpkplpkelleeaerrlkepp| BL:PDB:NREP 1 BL:PDB:REP 23->90|2hl7A|2e-13|44.1|68/82| RP:PFM:NREP 1 RP:PFM:REP 31->90|PF03918|2e-15|53.3|60/134|CcmH| HM:PFM:NREP 1 HM:PFM:REP 21->135|PF03918|2.1e-38|47.0|115/148|CcmH| OP:NHOMO 324 OP:NHOMOORG 232 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111--111------1-----1111111111----------1--------11---1-1-1111-1------1-----------1-1-1--------------------------------111-11-2------------------------11221111-11----1-1---21-----1-------121111----------------------------1------------------------------21-121111111111111111111111111---11--------21--2-12222221122-22222222222222222211-122---3231333333333322-2212222---111111-1111---1-----1111111-1221222---111--1-------11111111111111-1111111----------2222-1111222121122222223----111-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 68 STR:RPRED 48.9 SQ:SECSTR ######################HHHHHHHHHHHHEEcTTcccccTTTcccHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHTTTcEEccc################################################# DISOP:02AL 121-139| PSIPRED cHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHccccc //