[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : comA
DDBJ      :comA         comA operon protein 2
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  370/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->128 1vi8G PDBj 3e-27 46.0 %
:RPS:PDB   6->128 3dkzB PDBj 8e-22 18.6 %
:RPS:SCOP  14->128 1zkiA1  d.38.1.5 * 6e-27 24.6 %
:HMM:SCOP  2->128 1zkiA1 d.38.1.5 * 2e-34 33.3 %
:HMM:PFM   42->119 PF03061 * 4HBT 9.6e-20 38.5 78/79  
:BLT:SWISS 16->128 YDII_ECOLI 9e-27 46.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81522.1 GT:GENE comA GT:PRODUCT comA operon protein 2 GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1147268..1147681 GB:FROM 1147268 GB:TO 1147681 GB:DIRECTION + GB:GENE comA GB:PRODUCT comA operon protein 2 GB:PROTEIN_ID AAS81522.1 GB:DB_XREF GI:46197108 GB:GENE:GENE comA LENGTH 137 SQ:AASEQ MEVKAFLERETLDRTLGVRYLKAEKDEVVAELMVTPKVHQPFGFLHGGATVALAESVASVGGFLNCPPGHAAFGLEINCNHLRKKREGTIRAVGRPLHVGRTTQVWEVKVYDEEGRLVAASRCTLAVVPLEPAKEPA GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 16->128|YDII_ECOLI|9e-27|46.0|113/136| BL:PDB:NREP 1 BL:PDB:REP 16->128|1vi8G|3e-27|46.0|113/137| RP:PDB:NREP 1 RP:PDB:REP 6->128|3dkzB|8e-22|18.6|118/120| HM:PFM:NREP 1 HM:PFM:REP 42->119|PF03061|9.6e-20|38.5|78/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 14->128|1zkiA1|6e-27|24.6|114/126|d.38.1.5| HM:SCP:REP 2->128|1zkiA1|2e-34|33.3|126/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 463 OP:NHOMOORG 380 OP:PATTERN -----------------------1-------------------------------------------- ----11-2112-1121111-11--1111111111111323-1-1--11-1111221-2--11111111111---------1-1-----1111-1111--1-11111111----------------11111111111---11---1--------------------------------------31211---1-11111111111111111-1111111111----111111--11111111111111111111--1----1-----11---1-111111------------------------------------------------------------------------1---------1-----------1--1112-------111---11111--------------1--1-1------------------12---1---------------1-------------------------------------11-1-------------------111111-1--1---1-------1111-1111--2-------------11-1-3-11-1---------1--------1-----1-----------------------------111-1----111111111111111111111-------------222212-2222222222-223222222222222222222211111222222222222222212222222--111111111111----11111---------111111111111111------------1111-1121----1111----------111111111111111111111111--------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------1-----------------------------------------------------1-----------1---------1212-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 99.3 SQ:SECSTR HHHHHccccccHHHHTTcEEEEEcccEEEEEEcccGGGccTTccccHHHHHHHHHHHHHHHHHTTTTTcTTccEEEEEEEEEccccccEEEEEEEEEEEcccEEEEEEEEEcTTccEEEEEEEEEEEcEcHHHHHH# DISOP:02AL 6-7, 133-137| PSIPRED ccHHHHHccccccHHccEEEEEEcccEEEEEEEEcHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEccccccEEEEEEEEEEcccEEEEEEEEEEEccccEEEEEEEEEEEEccccccccc //