[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : degV.2
DDBJ      :degV         probable degV protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.119.1
:283 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->279 2dt8A PDBj 4e-18 28.7 %
:RPS:PDB   8->278 3eglA PDBj 1e-19 17.3 %
:RPS:SCOP  10->278 1pzxA  c.119.1.1 * 5e-38 20.9 %
:HMM:SCOP  8->282 1pzxA_ c.119.1.1 * 9.1e-63 35.3 %
:RPS:PFM   145->275 PF02645 * DegV 2e-12 32.3 %
:HMM:PFM   78->280 PF02645 * DegV 1.4e-43 35.0 203/211  
:BLT:SWISS 10->278 Y1491_THETN 5e-15 23.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80932.1 GT:GENE degV.2 GT:PRODUCT probable degV protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(566369..567220) GB:FROM 566369 GB:TO 567220 GB:DIRECTION - GB:GENE degV GB:PRODUCT probable degV protein GB:PROTEIN_ID AAS80932.1 GB:DB_XREF GI:46196516 GB:GENE:GENE degV LENGTH 283 SQ:AASEQ MASTPTASSVAFVADSTLGLSPEEAKSLGIHVVPQQVLHRGRSFRDLVEIAPGEVLRLLCSGERLTTSQVAPEDLRKLYEALLRTHGRVVSVHVSGLLSGTVDTAKKVAQAFGERVKVLDSWSLSGGLLLVLERARRLLEEGVAWEHLEEALAPYRERVRGYVLPATLDYLHRSGRIGGLQRFVGGLLRILPVLEVREGRVHPGPRVRGFAEGIRKVAALFRRDFLEEARVYLAHAENPEGAKALGEALKAGGVEVLGALPAGAAVSVHTGPGTVAAFAGPRG GT:EXON 1|1-283:0| BL:SWS:NREP 1 BL:SWS:REP 10->278|Y1491_THETN|5e-15|23.1|268/280| SEG 84->102|rthgrvvsvhvsgllsgtv| SEG 118->144|vldswslsgglllvlerarrlleegva| SEG 240->253|egakalgealkagg| BL:PDB:NREP 1 BL:PDB:REP 10->279|2dt8A|4e-18|28.7|268/277| RP:PDB:NREP 1 RP:PDB:REP 8->278|3eglA|1e-19|17.3|237/247| RP:PFM:NREP 1 RP:PFM:REP 145->275|PF02645|2e-12|32.3|130/210|DegV| HM:PFM:NREP 1 HM:PFM:REP 78->280|PF02645|1.4e-43|35.0|203/211|DegV| RP:SCP:NREP 1 RP:SCP:REP 10->278|1pzxA|5e-38|20.9|258/278|c.119.1.1| HM:SCP:REP 8->282|1pzxA_|9.1e-63|35.3|275/287|c.119.1.1|1/1|DAK1/DegV-like| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------11-------------------1----------------1---------------------------------------------------------------------------------------------------1---------------------------1----1----11-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 275 STR:RPRED 97.2 SQ:SECSTR ######ccccEEEEEGGGcccHHHHHHTTEEEEccEEEcTTEEEETTTTccHHHHHHHHHTcccEEEEcccHHHHHHHHHHHHHHTTTccEEEEcccTTccHHHHHHHHHTTTTcEEEEcccccTHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHTEEEEEEccccHHHHHTTcccGTTTccGGGGccccEEEEETTEEEEEcccHHHHHHHHHHHHHHTHHHTTcccEEEEEEEccHHHHHHHHHHHHHccTTEEEEEccHHHHHHHcTTEEEEEEEE## DISOP:02AL 1-5, 62-69| PSIPRED ccccccccEEEEEEEEcccccHHHHHHcccEEEEEEEEEccEEEEccccccHHHHHHHHHcccccEEccccHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccEEEEEEEcHHHHHHcccccHHHHHHHHHHccEEEEEEEccEEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHcccEEEEEEcccEEEEEEcccEEEEEEEEcc //