[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : dsbA
DDBJ      :dsbA         thiol:disulfide interchange protein dsbA
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  197/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:211 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   45->210 3f4rA PDBj 2e-18 31.1 %
:RPS:PDB   36->209 1bedA PDBj 3e-22 19.5 %
:RPS:SCOP  37->205 1z6mA1  c.47.1.13 * 4e-24 22.2 %
:HMM:SCOP  22->205 1z6mA1 c.47.1.13 * 1.1e-41 38.6 %
:RPS:PFM   51->207 PF01323 * DSBA 7e-13 38.8 %
:HMM:PFM   49->197 PF01323 * DSBA 6.7e-17 28.0 143/193  
:BLT:SWISS 39->209 BDBD_BACAN 7e-16 30.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80819.1 GT:GENE dsbA GT:PRODUCT thiol:disulfide interchange protein dsbA GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(458690..459325) GB:FROM 458690 GB:TO 459325 GB:DIRECTION - GB:GENE dsbA GB:PRODUCT thiol:disulfide interchange protein dsbA GB:PROTEIN_ID AAS80819.1 GB:DB_XREF GI:46196402 GB:GENE:GENE dsbA LENGTH 211 SQ:AASEQ MPRAIVLVVLGLALLGLGWILWGPKGKAGLDPAEGARFALGREDAPVVVVDFSNYLCPHCQNHALNVLPRLKAEYIDTGKVRYLFRDFPFPGQANVIRASEAAACAAEQGRYYDYHEVLFRAAAGWGNLTGEALDRYLVDLAGQIGLDEGAFAACLASGRHREEVLADQKLATDLGLTGTPTFFIAGEKHTGFLPYEEWKRLLDEALAKAE GT:EXON 1|1-211:0| BL:SWS:NREP 1 BL:SWS:REP 39->209|BDBD_BACAN|7e-16|30.9|165/217| TM:NTM 1 TM:REGION 3->24| SEG 4->23|aivlvvlglallglgwilwg| SEG 99->108|aseaaacaae| BL:PDB:NREP 1 BL:PDB:REP 45->210|3f4rA|2e-18|31.1|161/199| RP:PDB:NREP 1 RP:PDB:REP 36->209|1bedA|3e-22|19.5|169/181| RP:PFM:NREP 1 RP:PFM:REP 51->207|PF01323|7e-13|38.8|147/178|DSBA| HM:PFM:NREP 1 HM:PFM:REP 49->197|PF01323|6.7e-17|28.0|143/193|DSBA| GO:PFM:NREP 2 GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF01323|IPR001853| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF01323|IPR001853| RP:SCP:NREP 1 RP:SCP:REP 37->205|1z6mA1|4e-24|22.2|153/172|c.47.1.13| HM:SCP:REP 22->205|1z6mA1|1.1e-41|38.6|171/0|c.47.1.13|1/1|Thioredoxin-like| OP:NHOMO 297 OP:NHOMOORG 206 OP:PATTERN -----------------------11--11--1----------------------------------4A -16--111112---1------5----------31-3-3-1---11-11----1-2-------1---2-221-----------1--------------------------1--------------------------44544---41-------1------------11-2-------------12322------111111111111111--11-1111----------------------------------1--------------------------------------------------------------------------------------------------1---------------------2--122211111111111111111111111111111-111131112121211112121211111-24112122222111111111---11111111111111---1111-11-1--12211--------------------------------------------------------------------------------------12--1----------223233-1-------------------------------1-------------1----1-1-------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------1-------------------1-111111------------------------------------------------- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 89.1 SQ:SECSTR #######################cccccTTTEEEccccccTTTccccEEEEEEcTTcHHHHHHHHHHHHHHHHTccTTcEEEEEEcccccGGGHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHTTcccccccccHHHHHHHHHTTTccHHHHHHHHTcHHHHHHHHHHHHHHHHHTcccccEEEETTTcGGGcccHHHHHHHHHHHHHcHH DISOP:02AL 29-39| PSIPRED cHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHcccccEEEEEccEEEEccccHHHHHHHHHHHHHHcc //