[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : exbD
DDBJ      :exbD         putative biopolymer transport exbD protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->124 PF02472 * ExbD 6e-10 29.8 %
:HMM:PFM   8->123 PF02472 * ExbD 1.1e-15 31.9 113/130  
:BLT:SWISS 36->125 EXBD_SYNY3 8e-07 32.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80672.1 GT:GENE exbD GT:PRODUCT putative biopolymer transport exbD protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(310214..310591) GB:FROM 310214 GB:TO 310591 GB:DIRECTION - GB:GENE exbD GB:PRODUCT putative biopolymer transport exbD protein GB:PROTEIN_ID AAS80672.1 GB:DB_XREF GI:46196255 GB:GENE:GENE exbD LENGTH 125 SQ:AASEQ MSRRPLVLNLIPLIDFFLLLALFALLLARWPEALPQRALSVDLPRAEGRQGSGGVLLELDREGRLALNGKPVALKDLAQALSPLLQEGTAVRLEADREVPHGTVVAVLEAVRRAGGEKVEVGVRP GT:EXON 1|1-125:0| BL:SWS:NREP 1 BL:SWS:REP 36->125|EXBD_SYNY3|8e-07|32.2|90/269| TM:NTM 1 TM:REGION 9->31| SEG 16->28|fflllalfallla| RP:PFM:NREP 1 RP:PFM:REP 8->124|PF02472|6e-10|29.8|114/127|ExbD| HM:PFM:NREP 1 HM:PFM:REP 8->123|PF02472|1.1e-15|31.9|113/130|ExbD| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF02472|IPR003400| GO:PFM GO:0006810|"GO:transport"|PF02472|IPR003400| GO:PFM GO:0016020|"GO:membrane"|PF02472|IPR003400| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 42-56| PSIPRED cccccEEEEcccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEcccEEEEccEEccHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHccccEEEEEEcc //