[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : fecE
DDBJ      :fecE         iron(III) dicitrate transport ATP-binding protein fecE
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  888/915 : Eukaryota  156/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:250 amino acids
:PSIPRED
:BLT:PDB   13->226 3d31A PDBj 3e-20 33.0 %
:RPS:PDB   2->41 2awoD PDBj 1e-04 27.5 %
:RPS:PDB   14->225 3b5jA PDBj 5e-38 24.2 %
:RPS:SCOP  4->225 1b0uA  c.37.1.12 * 2e-35 26.6 %
:HMM:SCOP  14->216 1ii8.1 c.37.1.12 * 2.7e-60 44.1 %
:RPS:PFM   39->164 PF00005 * ABC_tran 4e-11 39.7 %
:HMM:PFM   39->164 PF00005 * ABC_tran 3.3e-20 34.5 116/118  
:HMM:PFM   21->48 PF02367 * UPF0079 0.00041 42.9 28/123  
:BLT:SWISS 15->225 YFMF_BACSU 3e-33 39.0 %
:PROS 136->150|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80740.1 GT:GENE fecE GT:PRODUCT iron(III) dicitrate transport ATP-binding protein fecE GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 381859..382611 GB:FROM 381859 GB:TO 382611 GB:DIRECTION + GB:GENE fecE GB:PRODUCT iron(III) dicitrate transport ATP-binding protein fecE GB:PROTEIN_ID AAS80740.1 GB:DB_XREF GI:46196323 GB:GENE:GENE fecE LENGTH 250 SQ:AASEQ MGGLEARGIVGPFALKGVDLLLRPGEWLALLGPNGSGKTTLLRVMAGLLRPRRGEVLLGGRPLRAYGSYERGRLLAYLPQNGPYPEGLLVEEVVRLGRLPHLGLWRREGKEDEEAVDWALEVTGASAFRGRLLGTLSGGERQRVLLARALAGRPRYLLLDEPTTFLDLAHQGVVVGLLRRLAGMGLGVLSVLHDPNQAALAHRVAVLEGGRVVAEGRPEAVLQEPLLARLYGAGVRVVRLGGRPHVYLDP GT:EXON 1|1-250:0| BL:SWS:NREP 1 BL:SWS:REP 15->225|YFMF_BACSU|3e-33|39.0|210/266| PROS 136->150|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 86->99|egllveevvrlgrl| SEG 172->189|gvvvgllrrlagmglgvl| SEG 228->243|arlygagvrvvrlggr| BL:PDB:NREP 1 BL:PDB:REP 13->226|3d31A|3e-20|33.0|197/348| RP:PDB:NREP 2 RP:PDB:REP 2->41|2awoD|1e-04|27.5|40/299| RP:PDB:REP 14->225|3b5jA|5e-38|24.2|211/243| RP:PFM:NREP 1 RP:PFM:REP 39->164|PF00005|4e-11|39.7|121/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 39->164|PF00005|3.3e-20|34.5|116/118|ABC_tran| HM:PFM:REP 21->48|PF02367|0.00041|42.9|28/123|UPF0079| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 4->225|1b0uA|2e-35|26.6|222/258|c.37.1.12| HM:SCP:REP 14->216|1ii8.1|2.7e-60|44.1|202/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 16027 OP:NHOMOORG 1112 OP:PATTERN HH93CC68998989B9S7CCBJEGIBEF9AAD51566185655AJDGNDEkQF5CKDJPGJ986H134 7DNAoHFINNNGHEECD88-8G44Eh99999AJMMOQggnBT9ZPVPLJHH8MRLDCI67LQLMiTVeerKBA99LAA99PEQ21432989718666--66A568E7775322222223255548AB78B57C9CDGIIRP558ULHEJKEDECICCB39A75DEBQPOG84B36322A4662HCCJIIH3AFITTTSTQRXJRSRSUTaRKKKITTQFLPYLBHEEEEEEkZDDDECEDBEEDDDDFC7567JGEBEHA688AJI67FHC457G9799JGIECBEEHH9CBA99ABB99BABBBBDDCBBBCKIH778HGIADLHGKKKKMMOKGLFENGGCFFCHFFBCfEDD9nmHEGHGBCGJGKC8FBH7LC6687B99ACEnmvAENWZQeTUWUTURWTTV*-JGWGDaJVmzC3***v*wv*****hY77ASc*dUdiYTS77777777LBA8CKEQ221--111----3111232112332312-574745PaTLVSYabcWPOMNMZZYkQPPQIQaXuQOWN25KKGNDFEFWLVPjvCGE4E69N58987877C77BHEDJWAGBEFFEGFEF5FHF8EACCDCEBBSTJR888A4566563-311111113C365BAKIM7I45767D5BDCB69BCBB98B9AACB1-2DA9B------cOgZCYGLSRPMONQLK-PLMKRMOKMLQQLKKKKKKfghXeDDELLKLMMMMNMKKMKLLbIHKNMLJA-MRSTVTSSRUVV1355443348888A4YOZAAABHF5AC997DCF68AA868579LFMNOKSYTTQUXPRDZbb222222222AGDDJCDCCDJFLEFA7875778992222119A55544433312111O5124233-1-21221---2242-2112AFEA5GHHLB6FA --22553-IC252742-2222214-4133----5653212112---3-32-121-33111-11--1----1----1---11--11--1-1-1-12111----111-133146C5C675161192893B1GxA375N4542A237635334833H2E98D23b34132F86I12641232l-3115722D2253-86473 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEcccccEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEHHHccHHHHHHHEEEEcccccccccccHHHHHHcccHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHEEEEEEccEEEEEccHHHHHccHHHHHHHccEEEEEEEccEEEEEEcc //