[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : ftsA
DDBJ      :ftsA         cell division protein ftsA
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  795/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:411 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   166->343 1jcgA PDBj 1e-13 32.0 %
:RPS:PDB   2->374 1e4gT PDBj 6e-44 19.7 %
:RPS:SCOP  5->191 1e4fT1  c.55.1.1 * 4e-13 18.9 %
:RPS:SCOP  193->346 1jceA2  c.55.1.1 * 4e-33 31.2 %
:HMM:SCOP  1->191 1e4fT1 c.55.1.1 * 4.8e-53 47.4 %
:HMM:SCOP  192->372 1e4fT2 c.55.1.1 * 1.8e-43 40.9 %
:RPS:PFM   80->190 PF02491 * FtsA 2e-06 33.9 %
:RPS:PFM   200->328 PF02491 * FtsA 4e-13 46.3 %
:HMM:PFM   3->190 PF02491 * FtsA 2.5e-36 32.3 164/172  
:HMM:PFM   200->369 PF02491 * FtsA 2.8e-43 42.9 163/172  
:BLT:SWISS 2->373 FTSA_PSEAE 7e-76 38.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81071.1 GT:GENE ftsA GT:PRODUCT cell division protein ftsA GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 707821..709056 GB:FROM 707821 GB:TO 709056 GB:DIRECTION + GB:GENE ftsA GB:PRODUCT cell division protein ftsA GB:PROTEIN_ID AAS81071.1 GB:DB_XREF GI:46196655 GB:GENE:GENE ftsA LENGTH 411 SQ:AASEQ MIIAGLDVGTTKVTTVIGELAPDGVLDIIGEGTVPSQGLRRGVVVNLERTTEAIRQSLFQAERVAGVKVERVVVGVGGPHLKSVTSHGLAAIRRGHTIAEADVERAIEQAKAYPFEGELELLHALPLEFKVDGQEGIRDPVGMAGVRLEVDVHLIAAGRGPLANLRRAVEEAGLALDAVCVQALASGLAVLTPEEEEMTVLLLDIGGGTTDVAVFRGGRLAHSAVVPLGGDHVTHDIAQLLKIPFEEAERVKRKYGAALPELADPELVLEINQEGGALGEVPAPELARIIRPRMREILHLARQSVDETLGPLEIQVNRVVLTGGGALLRGTDLLARQQYGLPVRVGKPQGVSGLTDVVASPAHAAAVGLVRYGASLPLKPQEAKRIREKPEDKPKGEGLWARIKEFLSNLF GT:EXON 1|1-411:0| BL:SWS:NREP 1 BL:SWS:REP 2->373|FTSA_PSEAE|7e-76|38.4|370/417| SEG 61->78|aervagvkvervvvgvgg| BL:PDB:NREP 1 BL:PDB:REP 166->343|1jcgA|1e-13|32.0|178/335| RP:PDB:NREP 1 RP:PDB:REP 2->374|1e4gT|6e-44|19.7|365/375| RP:PFM:NREP 2 RP:PFM:REP 80->190|PF02491|2e-06|33.9|100/164|FtsA| RP:PFM:REP 200->328|PF02491|4e-13|46.3|121/164|FtsA| HM:PFM:NREP 2 HM:PFM:REP 3->190|PF02491|2.5e-36|32.3|164/172|FtsA| HM:PFM:REP 200->369|PF02491|2.8e-43|42.9|163/172|FtsA| GO:PFM:NREP 2 GO:PFM GO:0007049|"GO:cell cycle"|PF02491|IPR003494| GO:PFM GO:0007049|"GO:cell cycle"|PF02491|IPR003494| RP:SCP:NREP 2 RP:SCP:REP 5->191|1e4fT1|4e-13|18.9|169/193|c.55.1.1| RP:SCP:REP 193->346|1jceA2|4e-33|31.2|154/196|c.55.1.1| HM:SCP:REP 1->191|1e4fT1|4.8e-53|47.4|190/193|c.55.1.1|1/1|Actin-like ATPase domain| HM:SCP:REP 192->372|1e4fT2|1.8e-43|40.9|181/191|c.55.1.1|1/1|Actin-like ATPase domain| OP:NHOMO 1337 OP:NHOMOORG 797 OP:PATTERN -----------------------------------------------------1-------------- 223-1---------------------------------112111---11-------------1------1------------121211111112221--11212212221111111111111111111211211213331122221-11--------111111---111111111111111121212211223433333333333333325444433323343233213232211111111111111-111111231111323211222232133211111111111111111111111111111111111111111111111-2222222222212121221222-12-131-212231333444323-22-21-222211111111111111111111111111111-111111111121111111111111112221111111111222222222222222222211111112222222222222221111-2232211111111111111111131111111112111111111111111111112232122221111111221112122222223222212222222232332322222222222222222222222212222222322212222222222122222222222221-2122211111122222222222222222-22222222222222222222222222222222222222222222222222222222222212222222222222222222121222222222122222222222222222222222222222222221111111112111222222222222222222222222221111122222222222211--------------------------3332222242221 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 391 STR:RPRED 95.1 SQ:SECSTR #EEEEEEEcccEEEEEEEEEcEccccEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHTccccccEEEEEccTTcEEEEEEEEEEcTccEEccHHHHHHHHHHHHHHccTTEEEEEEEEEEEEEccccEEcccTTEEEEEEEEEEEEEEHHHHHHHHHHHTTcccccccEEEEEHHHHHHHHHccHHHHHHcEEEEEcccccEEEEEEETTEEEEEEEEccccHHHHHHHHHHccccHHHHHHHHHHHcccccTTccccEEEEEcTTcccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHTccccccGccEEEEcGGGGcTTHHHHHHHHHcccEEEcccTccccccccTTcGGGHHHHHHHHTTcTGGGTHHHHHcEEHHHHH################### DISOP:02AL 377-399| PSIPRED cEEEEEEEcccEEEEEEEEEccccEEEEEEEEEccHHHHcccEEEcHHHHHHHHHHHHHHHHHHHccEEEEEEEEccccEEEEEEccEEEEccccccccHHHHHHHHHHHHHcccccccEEEEEEEEEEEEccHHHHHcHHHHcccEEEEEEEEEEEcHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHccccccccEEEEEEEcccEEEEEEEEccEEEEEEEEcHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccEEEEEEccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccHHHHHHHHHHHHHHcccEEEEccccccccHHHHcccHHHHHHHHHHHHHHccccHHHHHHcccccccccccccHHHHHHHHHHHcc //