[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : ftsK
DDBJ      :ftsK         cell division protein ftsK
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  825/915 : Eukaryota  4/199 : Viruses  1/175   --->[See Alignment]
a.4.5b.82.1c.37.1d.58.26d.74.3
:867 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   427->766 2iutA PDBj e-101 57.4 %
:BLT:PDB   799->856 2j5pA PDBj 4e-07 39.7 %
:RPS:PDB   426->782 3bjfA PDBj 1e-37 12.6 %
:RPS:PDB   798->853 1biaA PDBj 8e-04 16.1 %
:RPS:SCOP  423->513 1mg7A2  d.58.26.6 * 2e-08 13.1 %
:RPS:SCOP  549->636 1xppA  d.74.3.2 * 1e-22 16.1 %
:RPS:SCOP  641->824 1sfnA  b.82.1.11 * 7e-17 7.9 %
:RPS:SCOP  798->862 2ve8A1  a.4.5.67 * 2e-20 35.4 %
:HMM:SCOP  474->765 1e9rA_ c.37.1.11 * 8.6e-50 34.7 %
:HMM:SCOP  794->863 2j5oA1 a.4.5.67 * 2e-20 51.4 %
:RPS:PFM   515->690 PF01580 * FtsK_SpoIIIE 1e-52 64.2 %
:RPS:PFM   799->860 PF09397 * Ftsk_gamma 2e-12 59.7 %
:HMM:PFM   503->691 PF01580 * FtsK_SpoIIIE 3.4e-61 47.6 189/205  
:HMM:PFM   797->859 PF09397 * Ftsk_gamma 3.6e-25 57.1 63/67  
:BLT:SWISS 423->867 FTSKL_DEIRA e-173 69.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80822.1 GT:GENE ftsK GT:PRODUCT cell division protein ftsK GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(460856..463459) GB:FROM 460856 GB:TO 463459 GB:DIRECTION - GB:GENE ftsK GB:PRODUCT cell division protein ftsK GB:PROTEIN_ID AAS80822.1 GB:DB_XREF GI:46196405 GB:GENE:GENE ftsK LENGTH 867 SQ:AASEQ MPLMAKRGAAKRNKPNRSGETRALLLGAFALFLASGFLPGTGAVGDFLREAFYGALGLPAYLTPLGLLALAYLVYRGRPLKGFLRHLLFAYLVAFALLPLLGEALGGRLGAGMRAGLEAWLGWPGLALPLLAALALVDLWRGRPPWDLLRRGLVLGVGLVRRARLGLRRLALRRRLGLLARLYPEHTALKALAQSLAPEELSKVEEALRDFVRERVEEYARRMREDQRPLEPRVQALLQALKAPVPGEGPLRDALEERRAALLLEASALAARIAALSALPALSPTLSGLLRARRLREERRARWEEVAGLLEDLEARFDELSRWLAFLEANPQRQQEGLRALLTQSPPPAPAQAPEPEPEAFDLDLVFPEPERPAPPPAPAPSPPPAPAPGLLALPTPDLLDPPEPKERSRASEEEAERLKRTIAETLRHFGVQAEVVGHARGPSVTRYEILPAPGEKISRIQSLQNDLARALAVGAVRIEAPIPGKNTVGLEVPNPKRELVRLSEAVLSPAFQNAKALLPLVLGKSIEGEIWVKDLAKMPHLLIAGSTGSGKSVAINVLLHSLLFKHLPTTLRLLLIDPKMVELTPYEGIPHLIRPVVTSPEEAAGVLQGAVAHMERRYRLMSQVGARNLEQYNAKVGPEEALPYLVIVVDELADLMMTAPKEVEAAILRLAQMARATGMHLILATQRPSVDILTSLIKVNIPARLAFAVSSGFDSRTILDAQGAERLIGQGDALFHQPGLPKPVRLQVPYVSEEEVARVAGFLRGQSYEDRFAEAYGADFEPPKAVEGGGPGEVDFSDPLLKKAAEIVVEEGYGSVSRLQRRLSIGHARAGKLMDALEAMGIVGPPRGSKPREVLVTKDQLKDFFG GT:EXON 1|1-867:0| BL:SWS:NREP 1 BL:SWS:REP 423->867|FTSKL_DEIRA|e-173|69.5|443/980| TM:NTM 4 TM:REGION 21->43| TM:REGION 53->75| TM:REGION 82->104| TM:REGION 120->140| SEG 23->40|alllgafalflasgflpg| SEG 54->73|galglpayltplgllalayl| SEG 87->136|llfaylvafallpllgealggrlgagmragleawlgwpglalpllaalal| SEG 148->182|llrrglvlgvglvrrarlglrrlalrrrlgllarl| SEG 250->302|plrdaleerraallleasalaariaalsalpalsptlsgllrarrlreerrar| SEG 346->360|pppapaqapepepea| SEG 368->421|peperpapppapapspppapapgllalptpdlldppepkersraseeeaerlkr| BL:PDB:NREP 2 BL:PDB:REP 427->766|2iutA|e-101|57.4|340/408| BL:PDB:REP 799->856|2j5pA|4e-07|39.7|58/70| RP:PDB:NREP 2 RP:PDB:REP 426->782|3bjfA|1e-37|12.6|356/518| RP:PDB:REP 798->853|1biaA|8e-04|16.1|56/292| RP:PFM:NREP 2 RP:PFM:REP 515->690|PF01580|1e-52|64.2|176/186|FtsK_SpoIIIE| RP:PFM:REP 799->860|PF09397|2e-12|59.7|62/67|Ftsk_gamma| HM:PFM:NREP 2 HM:PFM:REP 503->691|PF01580|3.4e-61|47.6|189/205|FtsK_SpoIIIE| HM:PFM:REP 797->859|PF09397|3.6e-25|57.1|63/67|Ftsk_gamma| GO:PFM:NREP 7 GO:PFM GO:0000166|"GO:nucleotide binding"|PF01580|IPR002543| GO:PFM GO:0003677|"GO:DNA binding"|PF01580|IPR002543| GO:PFM GO:0005524|"GO:ATP binding"|PF01580|IPR002543| GO:PFM GO:0007049|"GO:cell cycle"|PF01580|IPR002543| GO:PFM GO:0007059|"GO:chromosome segregation"|PF01580|IPR002543| GO:PFM GO:0016021|"GO:integral to membrane"|PF01580|IPR002543| GO:PFM GO:0051301|"GO:cell division"|PF01580|IPR002543| RP:SCP:NREP 4 RP:SCP:REP 423->513|1mg7A2|2e-08|13.1|84/187|d.58.26.6| RP:SCP:REP 549->636|1xppA|1e-22|16.1|87/99|d.74.3.2| RP:SCP:REP 641->824|1sfnA|7e-17|7.9|178/245|b.82.1.11| RP:SCP:REP 798->862|2ve8A1|2e-20|35.4|65/67|a.4.5.67| HM:SCP:REP 474->765|1e9rA_|8.6e-50|34.7|265/433|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 794->863|2j5oA1|2e-20|51.4|70/0|a.4.5.67|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1222 OP:NHOMOORG 831 OP:PATTERN -----------------------------------------------1-------------------- 1111722222222223455-533343555553234331222333232122313432211133213346241211111111111-----111111111--11111111112111111111111111-11111111112112211121-11------------------11--------------11111111133444443244344342333333445234331133333421243333333333433222222121221111122112211211111122212222211111121111111111111111112111111111111511111111111112211111131121211323211111111111-1112111122222111212111111122222222222-22222322221222222222222222111111111111111111111111111121111111111111111111111111111111121111112322222222222222222222222222211222131112211111111111212222222111111112111111111111111111111111111111111111111111221211111111-11111111112111111111211111111111-11111------11111111111111111-1111111111111111111111111121111111111111111111111111-11111111111111-1111111111111111111-11111-11111111111111111111111111111111111111111111111111111111111111111121111111111111111111121111----1------1-----------------------211 -1-------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1--------------1---------- ------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------ STR:NPRED 428 STR:RPRED 49.4 SQ:SECSTR ######################################################################################################################################################################################################################################################################################################################################################################################################################################HccTcccccccccEEEEEccTTTccHHHHHHHTccEEEEETTcccHHHHHHHHTTTTcTTTccccEEEEEcccccEEcccccccccccEEEcTTcEEEEEEccGGGTTcccccEEEcccTTHHHHccTTcEEEETTTTEEEEEEEEccEEEEEEEEcEEEccccEEEcTTcccccccccHHHHHHHHHHHHHTccEEEETTcccHHHHHHHHHHHTHHHHHHccEEEEEHHHHHHHccGGGHHHHHHHHHHHHHHHTccEEEEccTTGGGGTcccccHHHHHHHHHHHHHTccEEEEcHHHHTcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHTccccccHHHHHHHHHHHHHHHTTH######ccHHHHHHHHHHHHTcccEEEEccccHHHHHHHTTcccHHHHHHHHHHHHHTTcccEEETTTEEEcc########### DISOP:02AL 1-21, 164-418, 776-798, 845-853| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccEEEEEEcccccEEEEEcccccccEEEHHHHHcccccccccccEEEEEEEcccccEEEEEccccccEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHcccccEEEHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccEEEEEEEcHHHHHHHccHHHHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHcccEEEEccccHHHHHHHcccccHHHccccccEEEEEcccccEEEEEEccccHHHHHHHHHHHHcccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccEEEccHHHHHHHcc //