[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : gcpE
DDBJ      :gcpE         gcpE protein
Swiss-Prot:ISPG_THETH   RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase;         EC=1.17.7.1;AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase;

Homologs  Archaea  0/68 : Bacteria  736/915 : Eukaryota  25/199 : Viruses  0/175   --->[See Alignment]
c.1.21d.134.1
:406 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   10->356 3e59B PDBj 4e-25 11.6 %
:RPS:SCOP  5->282 1q7mA1  c.1.21.2 * 8e-10 9.1 %
:RPS:SCOP  290->377 1aopA4  d.134.1.1 * 2e-06 17.1 %
:HMM:SCOP  10->236 1q7zA1 c.1.21.2 * 0.0004 22.8 %
:HMM:SCOP  289->401 1aopA4 d.134.1.1 * 2.8e-06 30.5 %
:RPS:PFM   8->396 PF04551 * GcpE 1e-65 46.4 %
:HMM:PFM   9->396 PF04551 * GcpE 2.7e-112 48.6 350/359  
:BLT:SWISS 1->406 ISPG_THETH 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82019.1 GT:GENE gcpE GT:PRODUCT gcpE protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1592432..1593652) GB:FROM 1592432 GB:TO 1593652 GB:DIRECTION - GB:GENE gcpE GB:PRODUCT gcpE protein GB:PROTEIN_ID AAS82019.1 GB:DB_XREF GI:46197606 GB:GENE:GENE gcpE LENGTH 406 SQ:AASEQ MEGMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGVEVPLVGDFHFNGHLLLRKYPKMAEALDKFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNASRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPSPKEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAPKA GT:EXON 1|1-406:0| SW:ID ISPG_THETH SW:DE RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; EC=1.17.7.1;AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase; SW:GN Name=ispG; Synonyms=gcpE; SW:KW 4Fe-4S; Iron; Iron-sulfur; Isoprene biosynthesis; Metal-binding;Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->406|ISPG_THETH|0.0|100.0|406/406| GO:SWS:NREP 6 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0008299|"GO:isoprenoid biosynthetic process"|Isoprene biosynthesis| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| TM:NTM 1 TM:REGION 234->256| SEG 169->183|sahevvlealvesav| SEG 242->252|asaaalaplll| RP:PDB:NREP 1 RP:PDB:REP 10->356|3e59B|4e-25|11.6|284/305| RP:PFM:NREP 1 RP:PFM:REP 8->396|PF04551|1e-65|46.4|345/353|GcpE| HM:PFM:NREP 1 HM:PFM:REP 9->396|PF04551|2.7e-112|48.6|350/359|GcpE| GO:PFM:NREP 3 GO:PFM GO:0016114|"GO:terpenoid biosynthetic process"|PF04551|IPR004588| GO:PFM GO:0046429|"GO:4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase activity"|PF04551|IPR004588| GO:PFM GO:0055114|"GO:oxidation reduction"|PF04551|IPR004588| RP:SCP:NREP 2 RP:SCP:REP 5->282|1q7mA1|8e-10|9.1|241/259|c.1.21.2| RP:SCP:REP 290->377|1aopA4|2e-06|17.1|82/145|d.134.1.1| HM:SCP:REP 10->236|1q7zA1|0.0004|22.8|189/0|c.1.21.2|1/1|Dihydropteroate synthetase-like| HM:SCP:REP 289->401|1aopA4|2.8e-06|30.5|105/145|d.134.1.1|1/1|Sulfite reductase hemoprotein (SiRHP), domains 2 and 4| OP:NHOMO 788 OP:NHOMOORG 761 OP:PATTERN -------------------------------------------------------------------- 111121111111-111111-1111211111111111111111111111111111111111111111122111111111111111111111111111---------1111111111111111111111111111111-----111-11111111111111111111111111111111111111111111111111111111111111111111111111111-11-111--111-----------------------------------------------------------------------------------------1111111111111111111111111111111111111111111111111-111111111111111111111111111111111111-11111111111-11111111111111111111111111111111111111111111111111111---------------111111111111111111111111111111111111111111111111111111111111111111111111111211111-111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111--11111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111-111---------1111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111--------11------------1------1------1111111111111 11------1---------------------------------------------------------------------------------------------------3-------------------------------------------------1---------------11111F111113122-2111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 339 STR:RPRED 83.5 SQ:SECSTR #HHHHHHHHcHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHHHHHHTcEEcccccccccTTTcccccccHHHHHHHHHHHHHTTcTTcEEEEEHHHHHHTTcEEEEEccHHHHGGGGTHHHTTccHHHHHHHHHHHHHHHHHTTcTTEEEEcGGGcGGGGGGTTcHHHHHHHTGGTTcHHHHHHHHHHHHcccHHHHHHHHTTcHHHHHHHHHHHHHHHHHccTTccccHHHHHHHHHHHHHHHHHHHHHcTTcEEEEcccccTTHHHHccEEEccccTTccccccGGGcEEEEETTEEEEEcHHHHHHHHHHHTTcEE############HTTTcEEEEETT####EEEEE################################################## DISOP:02AL 1-4, 403-406| PSIPRED ccccccccEEEEEEEEEEcccccEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHccccccEEEEEEEcHHHHHHHHHHHHHHHccEEccccccccccccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEccccccccccEEEEcccccccccccEEEccEEEEEEccccHHHHHHHHHHHHHHHHccccc //