[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : gufA
DDBJ      :gufA         zinc uptake transporter/gufA protein
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  115/915 : Eukaryota  57/199 : Viruses  0/175   --->[See Alignment]
f.34.1
:264 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  68->162 2oauA3 f.34.1.1 * 0.00065 33.7 %
:HMM:PFM   7->91 PF02535 * Zip 1.1e-06 29.4 85/319  
:HMM:PFM   95->259 PF02535 * Zip 7e-26 32.7 153/319  
:BLT:SWISS 5->71 ZUPT_DESOH 1e-05 37.3 %
:BLT:SWISS 98->264 S39AB_XENTR 7e-20 33.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81920.1 GT:GENE gufA GT:PRODUCT zinc uptake transporter/gufA protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1497147..1497941 GB:FROM 1497147 GB:TO 1497941 GB:DIRECTION + GB:GENE gufA GB:PRODUCT zinc uptake transporter/gufA protein GB:PROTEIN_ID AAS81920.1 GB:DB_XREF GI:46197507 GB:GENE:GENE gufA LENGTH 264 SQ:AASEQ MEPFLLYALLGGLFTWGLTAVGAASVFFAREPSRKLLDAMLGFAAGVMLAASVFSLLVPGMEMAEAQGKNPIFPAVVGFLLGGGLIRLLDRYLPHVHLGPKDAPEGLKTLWRRTTLLILAIALHNFPEGLAVGVAFGAAGLDPTGAATLGGAIALALGIGLQNLPEGLAIAWPLRRVGIGAGLAWFYGQLSAIVEPLGAVLGALLVAQMMALLPYLMAMAAGAMVFVVVEEVIPESQAEGNGDLATFGVMTGFALMMALDVALG GT:EXON 1|1-264:0| BL:SWS:NREP 2 BL:SWS:REP 5->71|ZUPT_DESOH|1e-05|37.3|67/289| BL:SWS:REP 98->264|S39AB_XENTR|7e-20|33.9|165/336| TM:NTM 8 TM:REGION 6->28| TM:REGION 39->61| TM:REGION 70->92| TM:REGION 115->137| TM:REGION 145->167| TM:REGION 182->204| TM:REGION 213->235| TM:REGION 244->264| SEG 78->89|gfllggglirll| SEG 129->141|glavgvafgaagl| SEG 144->161|tgaatlggaialalgigl| SEG 197->229|lgavlgallvaqmmallpylmamaagamvfvvv| HM:PFM:NREP 2 HM:PFM:REP 7->91|PF02535|1.1e-06|29.4|85/319|Zip| HM:PFM:REP 95->259|PF02535|7e-26|32.7|153/319|Zip| HM:SCP:REP 68->162|2oauA3|0.00065|33.7|83/0|f.34.1.1|1/1|Mechanosensitive channel protein MscS (YggB), transmembrane region| OP:NHOMO 213 OP:NHOMOORG 191 OP:PATTERN ----1-------------------1--1--1---1---11111-------11--11-1111---1--- ------------------------------------------------------------------------------1-1-1---11------------1--11---1---------------------1----1---------11-------1-----------1-1----------------111-----------------------------------1-111111--1---------------1111-----------------------------1------------------------------1111--1111--1--111111111-1-------11111-11--------11------1---11---2-----------------------------------------------------------2-------------------------------------------------------------1-11-----------------------------------1--------------------------------1-1---1--1111-------11----1---------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1--1-1111----------------------111111111-1-1----------------------------------------------111----11111111--1---------------------------1--11111--- ------1-----------------------------------------------------------------------------------------------------3-2-111-1111-11-32121161-111111111131-11--11---1-1111-1-11-14131121-------------------11111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 94-112| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcc //