[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : hesB
DDBJ      :hesB         hesB protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  622/915 : Eukaryota  179/199 : Viruses  0/175   --->[See Alignment]
b.124.1
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->112 2apnA PDBj 7e-29 48.2 %
:RPS:PDB   1->112 2apnA PDBj 1e-39 48.2 %
:RPS:SCOP  9->102 1r94A  b.124.1.1 * 3e-32 34.4 %
:HMM:SCOP  7->100 1nwbA_ b.124.1.1 * 8.6e-30 44.7 %
:RPS:PFM   9->100 PF01521 * Fe-S_biosyn 1e-22 52.2 %
:HMM:PFM   9->100 PF01521 * Fe-S_biosyn 3.3e-30 47.3 91/91  
:BLT:SWISS 1->112 ERPA_HAEIG 1e-28 48.2 %
:PROS 95->112|PS01152|HESB

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81614.1 GT:GENE hesB GT:PRODUCT hesB protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1226026..1226406) GB:FROM 1226026 GB:TO 1226406 GB:DIRECTION - GB:GENE hesB GB:PRODUCT hesB protein GB:PROTEIN_ID AAS81614.1 GB:DB_XREF GI:46197200 GB:GENE:GENE hesB LENGTH 126 SQ:AASEQ MVETQEAVIRITPLAAEKAKEILARYGKEHAAIRVYIKSGGCSGFQYGMAVDERELPGDTFVEMHGVRLVVDRMSLPYLVGSEIDWVESLMGGGFTVHNPNAVSTCGCGHSFRTKDQEGTPRTCGH GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 1->112|ERPA_HAEIG|1e-28|48.2|112/114| PROS 95->112|PS01152|HESB|PDOC00887| BL:PDB:NREP 1 BL:PDB:REP 1->112|2apnA|7e-29|48.2|112/114| RP:PDB:NREP 1 RP:PDB:REP 1->112|2apnA|1e-39|48.2|112/114| RP:PFM:NREP 1 RP:PFM:REP 9->100|PF01521|1e-22|52.2|92/92|Fe-S_biosyn| HM:PFM:NREP 1 HM:PFM:REP 9->100|PF01521|3.3e-30|47.3|91/91|Fe-S_biosyn| RP:SCP:NREP 1 RP:SCP:REP 9->102|1r94A|3e-32|34.4|93/97|b.124.1.1| HM:SCP:REP 7->100|1nwbA_|8.6e-30|44.7|94/101|b.124.1.1|1/1|HesB-like domain| OP:NHOMO 1544 OP:NHOMOORG 811 OP:PATTERN ------------------------1--11-11------------------111-------------11 1111111111111111111-111111111111111111111222111111111111111111111111111-----------112111-----------1-1111111-2--------------1---------2-11111---112333332111111111-2222433311111111111111111---1111111111111111111111111111111111------211111111111111-111111--------------------------------------------------------------------------------------------------1----11---------------1-1222222222432332223333322222222222-2232232223221222333222223322222233332222222222213312223-1111---112222222222222221111222223222222222222222222222222222442222222224222224232222322222222222222222331-----------------------222222---------------------------332221221122122222222222222212221--222211111123232323333333333-333333333333322332333333332333333333333333333323333223333333333331222222221111422222222222222222222222222222322222222222222222211111111122222222222232222222222222222223-----------------------------------------------------42- 2---222-3---22221221222211111221-222111121121211112222-11-1111222111-2211221111111212122--2212221122221333-2223322321-2222223212-362-223221121222122-121-2133232122211-224313222332S2223375561433232222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 89.7 SQ:SECSTR cccccccccEEccHHHHHHHHHHHHHTccccEEEEcccccccccccccEEEccccccccEEEEccccEEEEcHHHHHHHTTcEEEEEccccccEEEEEcHHHHcccccccccc############# DISOP:02AL 1-6, 115-126| PSIPRED cccccccEEEEcHHHHHHHHHHHHcccccccEEEEEEEccccccEEEEEEEccccccccEEEEEcccEEEEcHHHHHHHcccEEEEEEccccccEEEEcccccccccccccccccccccccccccc //