[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : hisF
DDBJ      :hisF         hisF protein
Swiss-Prot:HIS6_THET2   RecName: Full=Imidazole glycerol phosphate synthase subunit hisF;         EC=4.1.3.-;AltName: Full=IGP synthase cyclase subunit;AltName: Full=IGP synthase subunit hisF;AltName: Full=ImGP synthase subunit hisF;         Short=IGPS subunit hisF;

Homologs  Archaea  55/68 : Bacteria  715/915 : Eukaryota  116/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:252 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->252 1ka9F PDBj e-130 99.2 %
:RPS:PDB   3->252 2a0nA PDBj 2e-36 53.6 %
:RPS:SCOP  3->252 1gpwA  c.1.2.1 * 4e-86 53.2 %
:HMM:SCOP  2->250 1thfD_ c.1.2.1 * 2.9e-83 49.4 %
:RPS:PFM   6->233 PF00977 * His_biosynth 4e-60 60.6 %
:HMM:PFM   6->233 PF00977 * His_biosynth 9.6e-90 57.1 224/228  
:BLT:SWISS 1->252 HIS6_THET2 e-131 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81421.1 GT:GENE hisF GT:PRODUCT hisF protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1048652..1049410 GB:FROM 1048652 GB:TO 1049410 GB:DIRECTION + GB:GENE hisF GB:PRODUCT hisF protein GB:PROTEIN_ID AAS81421.1 GB:DB_XREF GI:46197006 GB:GENE:GENE hisF LENGTH 252 SQ:AASEQ MSLAKRIVPCLDVHAGRVVKGVNFVNLRDAGDPVEAARAYDEAGADELVFLDISATHEERAILLDVVARVAERVFIPLTVGGGVRSLEDARKLLLSGADKVSVNSAAVRRPELIRELADHFGAQAVVLAIDARWRGDFPEVYVAGGRVPTGLHAVEWAVKGVELGAGEILLTSMDRDGTKEGYDLRLTRMVAEAVGVPVIASGGAGRMEHFLEAFQAGAEAALAASVFHFGEIPIPELKRYLAEKGVHVRLD GT:EXON 1|1-252:0| SW:ID HIS6_THET2 SW:DE RecName: Full=Imidazole glycerol phosphate synthase subunit hisF; EC=4.1.3.-;AltName: Full=IGP synthase cyclase subunit;AltName: Full=IGP synthase subunit hisF;AltName: Full=ImGP synthase subunit hisF; Short=IGPS subunit hisF; SW:GN Name=hisF; OrderedLocusNames=TT_C1079; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Histidine biosynthesis; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->252|HIS6_THET2|e-131|100.0|252/252| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| SEG 211->225|fleafqagaeaalaa| BL:PDB:NREP 1 BL:PDB:REP 2->252|1ka9F|e-130|99.2|251/251| RP:PDB:NREP 1 RP:PDB:REP 3->252|2a0nA|2e-36|53.6|250/251| RP:PFM:NREP 1 RP:PFM:REP 6->233|PF00977|4e-60|60.6|226/229|His_biosynth| HM:PFM:NREP 1 HM:PFM:REP 6->233|PF00977|9.6e-90|57.1|224/228|His_biosynth| GO:PFM:NREP 1 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF00977|IPR006062| RP:SCP:NREP 1 RP:SCP:REP 3->252|1gpwA|4e-86|53.2|250/253|c.1.2.1| HM:SCP:REP 2->250|1thfD_|2.9e-83|49.4|249/0|c.1.2.1|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 1654 OP:NHOMOORG 886 OP:PATTERN ---2--1111111112-1111112222222222222223222222222322222-1-112-1----22 2111222222222212222-22112222222222222122222221122221222222--212222211122222222--22122222222222-----2-222222223---------------222222223222222233322222222222223223222222222223122334233222222112222222222222222222222222222222122222222221-11111111111111211-1----22-2---22--22----2-222-------222------------------------2----2----22-2222222-2-2222222---3-2--1222222222222222222--22222222-----222222322222222222222222122222222222-2222222322222222222222222332222222222222222-----------------------------2322122222222222222222222222222222222222222222222232224233222222222222222222214231222222222-2223223222222123342222333333-2-------22222222222222122222222222222222222222--222222122221222222222222222-2222222222222222222222223322222222222222222222222222-22222221222222-1-----333322321222222-2221---2222222222222323222222222222222--------222222222222224222121122222222232112222--------------------------------------1--2-222211 ------1-----111111111111211111111111111111111111111111-111111111111111111111111111111-11-12111111111121111-1-----------------------------------------------------------------3-1-128111111113111111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 100.0 SQ:SECSTR EEcccEEEEEEEEETTEETTccccTTcccTTcHHHHHHHHHHHTccEEEEEEcccHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHTccEEEEcHHHHHcTHHHHHHHHHHcGGGEEEEEEEEEETTEEEEEETTTTEEEEEEHHHHHHHHHHTTccEEEEEETTTTTccccccHHHHHHHGGGccccEEEEcccccHHHHHHHHHTTccEEEEcHHHHTTcccHHHHHHHHHHTTcccccc PSIPRED cccccEEEEEEEEEccEEEEEEccccEEccccHHHHHHHHHHccccEEEEEEccHHcccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEccHHHccHHHHHHHHHHcccccEEEEEEEEEEccccEEEEEcccccccccHHHHHHHHHHccccEEEEcccccHHccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEEHHHHcccccHHHHHHHHHHcccccccc //