[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : livF.1
DDBJ      :livF         branched-chain amino acid transport ATP-binding protein livF
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  903/915 : Eukaryota  147/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:277 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   25->256 1ji0A PDBj 8e-52 51.4 %
:RPS:PDB   16->254 2d3wB PDBj 1e-28 20.6 %
:RPS:SCOP  16->256 1ji0A  c.37.1.12 * 7e-40 50.0 %
:HMM:SCOP  13->259 1g6hA_ c.37.1.12 * 2.3e-56 38.8 %
:RPS:PFM   57->182 PF00005 * ABC_tran 1e-06 31.6 %
:HMM:PFM   57->181 PF00005 * ABC_tran 4.7e-16 31.0 116/118  
:HMM:PFM   43->67 PF02463 * SMC_N 0.00017 48.0 25/220  
:BLT:SWISS 26->254 LIVF_SALTY 1e-43 42.6 %
:PROS 155->169|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80431.1 GT:GENE livF.1 GT:PRODUCT branched-chain amino acid transport ATP-binding protein livF GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 74033..74866 GB:FROM 74033 GB:TO 74866 GB:DIRECTION + GB:GENE livF GB:PRODUCT branched-chain amino acid transport ATP-binding protein livF GB:PROTEIN_ID AAS80431.1 GB:DB_XREF GI:46196013 GB:GENE:GENE livF LENGTH 277 SQ:AASEQ MDALNPIRPEDLGPTLLLVNNIEVVYHDVIQVLRGVSLKVPEGRITALLGPNGAGKTTTLRAISGLLIPEDGEVVRGEILFRGTPIQGRPPEEIVKLGIVQVLEGRRVFKHLTVEENLKVGTLTRRGVNLKEELDRIYHYFPRLAELRHRLAGYCSGGEQQMIAIGRALLAKPRLLLLDEPSLGLAPLLVREIFDIVARVNAEEGVTVLVVEQNARVALSIAHYGYIMESGRIVLEGDRAYLLENPDVQEFYLGVAKEGGRKSFKEVKAYKRRKRFM GT:EXON 1|1-277:0| BL:SWS:NREP 1 BL:SWS:REP 26->254|LIVF_SALTY|1e-43|42.6|223/237| PROS 155->169|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 167->178|rallakprllll| BL:PDB:NREP 1 BL:PDB:REP 25->256|1ji0A|8e-52|51.4|218/231| RP:PDB:NREP 1 RP:PDB:REP 16->254|2d3wB|1e-28|20.6|233/244| RP:PFM:NREP 1 RP:PFM:REP 57->182|PF00005|1e-06|31.6|117/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 57->181|PF00005|4.7e-16|31.0|116/118|ABC_tran| HM:PFM:REP 43->67|PF02463|0.00017|48.0|25/220|SMC_N| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 16->256|1ji0A|7e-40|50.0|234/240|c.37.1.12| HM:SCP:REP 13->259|1g6hA_|2.3e-56|38.8|240/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 26139 OP:NHOMOORG 1118 OP:PATTERN JJD5LFDAKKJIIHK8b8NJHJHReEGOSDMOA5A9A4B9995AMDNNFGjYR8HNILNJHCB5S166 BIKD*JCMSSTEF8IDB99-9O44Ds989999RSRTZorpLjHnSSOMMIGCXaVF9J66VXiHlTctnpQKIIIaMMC9NFZ64879FFAB48672--79A6A7L8FA6244444454544448EF9DEC8EGHBQQQdeA9BaSKHNOHGMIMDEC8BBC9NKLMWWUD9C6B876C7B99XROQMON3ESZtttsus*zfuzuvxyrfTTUbwv*PddnbPPQRRSRQ**IIIIJIIJIIIIIHIHHGJDXKGHWVFGKHIUTEFSVLGEJNJMNNVSTSQOURSRUXVYQRSXUWVNMMMMNOOOOOMMZQQIHIQPRSMraiqstsruttOqSPcddIPROeUQNI*FINEnoPXNMVUILRHSOEEHGGHIGGC8BC9CLH***JEa*t**qqsmqqmtmpo*-Ua*QM*Us**G5**************A8Bgp**v***l*GGGGGGGGjKM7GUHb22222333331112333121121131111E46886n**m*y*****dbcdbuu**mijiWp***tw*m7CeffpUiUb*v****JVQAD7DQH9898789HBFLZWNruKQMfTJWWQQYCRINELNSFFNQOPVZNk765B79977873644444449D96597SOeAVFCAA7XACCDD7FFDDDBBDE9DDC4-3BGEG11----hh*qJtVceebdaYcaZ-dcaZcZbaZaeeZWYbYXXx*yswMKLSTSSSTSTTTSRURSSsVTRXXVYA2hmnnqnojmrrr22A889789DCDCCCcWyLLJOILAEEDEJEFLABCBB7H8DEWJUSTTcro*YhhfZRyps6654556568LOOVQRRRRVWZYZCCBAAAAACB777712CGA9999B45543543L5C62423-437-653111655474223JTTAGOfPROANE --11672-8612365212111111-1-11-----2--1--------2-221131--111111121-1----1-11-----1-----1--121111-------1---25115897EC752615A7PM3E2R*D1A6B8553C45GA39434F22b4DA6N36A1B3B29AFR36B53271722-13943K1A611BAAA2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED cccccccccccccccEEEEEEEEEEEccEEEEEEcccEEEcccEEEEEEccccccHHHHHHHHHcccccccccEEEEEEEEEcEEcccccHHHHHHHHccccccccEEcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccEEEEcccHHHccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHccHHHHHHHccccccccHHHHHHHHHHHHHcccc //