[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : livF.2
DDBJ      :livF         branched-chain amino acid transport ATP-binding protein livF
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  903/915 : Eukaryota  184/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:258 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->239 1ji0A PDBj 5e-43 48.0 %
:RPS:PDB   1->234 3cmvG PDBj 1e-34 11.1 %
:RPS:SCOP  1->239 1ji0A  c.37.1.12 * 3e-41 45.7 %
:HMM:SCOP  1->244 1g6hA_ c.37.1.12 * 6.7e-53 38.1 %
:RPS:PFM   42->167 PF00005 * ABC_tran 3e-07 34.5 %
:HMM:PFM   42->166 PF00005 * ABC_tran 6.7e-14 30.1 113/118  
:HMM:PFM   30->52 PF02463 * SMC_N 3.7e-05 47.8 23/220  
:BLT:SWISS 1->239 LIVF_SALTY 1e-45 43.1 %
:PROS 140->154|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80567.1 GT:GENE livF.2 GT:PRODUCT branched-chain amino acid transport ATP-binding protein livF GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(205604..206380) GB:FROM 205604 GB:TO 206380 GB:DIRECTION - GB:GENE livF GB:PRODUCT branched-chain amino acid transport ATP-binding protein livF GB:PROTEIN_ID AAS80567.1 GB:DB_XREF GI:46196149 GB:GENE:GENE livF LENGTH 258 SQ:AASEQ MLSVENLKVVYRGVILALDGVSLEVGEGEAVALLGPNGAGKSSLVRAIAGLLPKFEGRVLDGKVRLFGREATHLDPVGISQMGLTAILEGRPLFRYLTPVENLMAAGHRLPPKALKEGMEEVFARFPRLYERRHEQAGYLSGGEQQMLLLGMALLTRPRLLVVDEPSLGLAPKLVGEVMQTLEALRREKGLSLLLVEQNARAALGVVDRVYVLERGRVVFEGSAKEAMEDQDVMEFYLGKEEVGFRQARRYRRRKRWV GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 1->239|LIVF_SALTY|1e-45|43.1|232/237| PROS 140->154|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 246->256|rqarryrrrkr| BL:PDB:NREP 1 BL:PDB:REP 1->239|1ji0A|5e-43|48.0|225/231| RP:PDB:NREP 1 RP:PDB:REP 1->234|3cmvG|1e-34|11.1|226/1167| RP:PFM:NREP 1 RP:PFM:REP 42->167|PF00005|3e-07|34.5|113/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 42->166|PF00005|6.7e-14|30.1|113/118|ABC_tran| HM:PFM:REP 30->52|PF02463|3.7e-05|47.8|23/220|SMC_N| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->239|1ji0A|3e-41|45.7|232/240|c.37.1.12| HM:SCP:REP 1->244|1g6hA_|6.7e-53|38.1|236/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 38300 OP:NHOMOORG 1155 OP:PATTERN UUG8LKFETTTSSOUKjGSOJMPYlGIabJUTG6CCA4HCEA8LTJSXIK*rb8NUQQTKMFGBY185 QQZK*SUVffeOOJOKNJJ-JU77Q*KKKKKJifdfo***O*Q*isjZeXPNtuoKMTCDon*T*in***bSRQQhSPRJpYj9798BNMJF4FCGE--CELCHHUFPGL57666575656666DNLGISIDNQNJfggsvEEDqahXjoWVcZePPIGJFFEZcVfuwxOCKBF9BDIAGDAeWXZWia6RXo********r*******zrrmo***Yns*xZedggdfd**PPPOPOOLOOPPPOOONLJQjVMNnkNJONRgeGGfhNMGOZTRVVhgheeYhiigiihiegglhhhUTUTTUUUXVVUSkdcSRTecfba*ltw******zWzWZvllRTVT*abZU*ReNH**caWVcbNUUOfYMOPOKYNPPICEHDGYS***TJm****************-ah*aS*g***Q6**************EGL**********QPQQQQQQrUYIOeU*33535222443355664644456665363IBADBB***********rtsup*****y*zh********8Krsn*eolq******QfXESGNbOFEFEFFFNJKXhiTw*MUUoaQdqXXcHaTYNPXYPUWXUajqTyABCH8CCEFAA787676867DLBBDHGefmGlNOGKEmJKMNLELPOMOIQLOKLMQ4-9ENKK1-----*p**P*mpuurqtrtno-upopunrqqpvtumnommn*****aXTghceefeeffcdfdeb*jffkkilO2w***********22CEBCABCIIHINF*m*RQQTPQGILJIQKPVIJLIJCMDIKiPsruqs***l**trg***888677888ESaXqefgffnrnnnJKJHGHIFHGCCCC33IMJJGGGH78757656q9G43638-5691742754697474222ShgNObzedeAWK --22EFB-C7379FC845577C966778745349996756577334759BA7D885A35643311-1-1---13111--11---1222-754424343532-3A8838GLOHHCOIED8748HCTd5X5**W2SGTEAB6Q6AQI6E887OB7*9IHHd6M*7SEK5fIOmLRLCEC97*324EFUCAq4TU99bKVMD ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 258-259| PSIPRED cEEEEEEEEEEcccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEEEEEEccEEcccccHHHHHHcccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHcHHHHHHHcccccccHHHHHHHHHHcccc //