[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : livG.1
DDBJ      :livG         branched-chain amino acid transport ATP-binding protein livG
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  900/915 : Eukaryota  166/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:253 amino acids
:PSIPRED
:BLT:PDB   1->250 1g6hA PDBj 8e-40 37.1 %
:RPS:PDB   4->250 2d3wB PDBj 4e-33 20.8 %
:RPS:SCOP  4->251 1ji0A  c.37.1.12 * 9e-44 32.2 %
:HMM:SCOP  4->255 1g6hA_ c.37.1.12 * 2.1e-65 40.8 %
:RPS:PFM   43->99 PF00005 * ABC_tran 5e-05 39.6 %
:RPS:PFM   228->250 PF12399 * BCA_ABC_TP_C 2e-04 69.6 %
:HMM:PFM   43->179 PF00005 * ABC_tran 1.4e-20 34.5 116/118  
:HMM:PFM   228->250 PF12399 * BCA_ABC_TP_C 9e-13 69.6 23/23  
:HMM:PFM   22->55 PF03193 * DUF258 7.4e-05 21.2 33/161  
:BLT:SWISS 4->250 BRAF_PSEAE 2e-50 39.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80426.1 GT:GENE livG.1 GT:PRODUCT branched-chain amino acid transport ATP-binding protein livG GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 68107..68868 GB:FROM 68107 GB:TO 68868 GB:DIRECTION + GB:GENE livG GB:PRODUCT branched-chain amino acid transport ATP-binding protein livG GB:PROTEIN_ID AAS80426.1 GB:DB_XREF GI:46196008 GB:GENE:GENE livG LENGTH 253 SQ:AASEQ MAQLDVEGVTLTFGGVAALSGVSMRVEAGELVSIIGPNGAGKTSLLNCISGFYHPERGRILFEGQDLTRASPHEVTRKGIARAFQNIELFSGLTVLENLLLARHTHLSYGLLQAGLFYGRALAEEVRNRRVVEEVIDFMELEPYRKALVGNLPYGVRKRVEVARALALSPKLLLLDEPMAGMTLEEKEDMVRFILEIRARGTTVVLIEHDLGVVMDISDRVYVLDFGQVIAEGRPEEVAKNPRVQEAYMGVEV GT:EXON 1|1-253:0| BL:SWS:NREP 1 BL:SWS:REP 4->250|BRAF_PSEAE|2e-50|39.4|246/255| SEG 124->135|eevrnrrvveev| SEG 163->175|aralalspkllll| BL:PDB:NREP 1 BL:PDB:REP 1->250|1g6hA|8e-40|37.1|248/254| RP:PDB:NREP 1 RP:PDB:REP 4->250|2d3wB|4e-33|20.8|240/244| RP:PFM:NREP 2 RP:PFM:REP 43->99|PF00005|5e-05|39.6|53/123|ABC_tran| RP:PFM:REP 228->250|PF12399|2e-04|69.6|23/23|BCA_ABC_TP_C| HM:PFM:NREP 3 HM:PFM:REP 43->179|PF00005|1.4e-20|34.5|116/118|ABC_tran| HM:PFM:REP 228->250|PF12399|9e-13|69.6|23/23|BCA_ABC_TP_C| HM:PFM:REP 22->55|PF03193|7.4e-05|21.2|33/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 4->251|1ji0A|9e-44|32.2|233/240|c.37.1.12| HM:SCP:REP 4->255|1g6hA_|2.1e-65|40.8|250/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 25328 OP:NHOMOORG 1134 OP:PATTERN KK84EC78BBAAB5C7U9IIGKKQbAEOP9SN749A95C9A87CLJMPBEdWN7DLHFDFD676M142 CERC*ICIKKKA98ECCBB-BO55FoBBBBBCROMPUirlLhLwQTMGNNGAYPW8EG44ZSpEgPV*ouKJDBBQHGACQEa33455CCA84A678--77D749E9IDA21222213444444ADBAADA9EFIBQUTYYBABWUKGRTFEPTRGHC878A8OHOOZYYF996754582665UTSQPQO3EMWfgfefdmiXgnfefohZWWXViipHZaaUJLPPPNOO**FGGGGGGEHHGGGHHECBFCUJBHWXEEHDKUSDEVVKEAHLILKJQPQRQNQQTSUTSUQOTVTVUGGGGFGGHFGGGGTPONNPTRTLSlXYibcbbbcaMcMNXYYJHHHiNRODsBJJGrrJOQQSIJPKEKXBFJCELIFFFBC9BBMK***LFb*v**oprotqkuoop*-Ya*WP*X***H5**************CACok**x***p*DCDDDDDDsPQ9GWRj33312222231112122122111122-11H67B95q**u*******kiijexx**rlppZo***t**n6FklhwTgTa*v****LWUDI6HUH9899999FEENXbHv*HRNhRIWWMLXAOFOGJKOGINMQNYeMv699C7AAAA884442343447C74AA9TTb9aEE6B4VCFFHG9ELDCCCBEGBEEA2-49LAC------khxqMkWaccabcZcZY-caYaZXbZbadcZWXZXWZ***suPPKVTQSSUUUUURRURSSwSRRUVUYF-mopqtsrlotts23D799799DDEGB7iXvKJLOKL8CECEGFILCDEDD8F6DETLeeabc*l*ZgjceRwtw8776767678KONTMNNNNRVMTQ9989698899999911BD99787855555555Q8C64742-4422576544428786333LQQDEJaISJ8OC ----423-3112232332112213333331-11233-212-12211142-41141121112--11----1--1-1------111111--12-321134312--132221-B88AH9F6131483BD1B1IoA245E33-16447735212952R4856O34528453L8AR7F82435-A22223833R1832-D4961 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEcEEEEEccEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHcccccccccccccccccHHHHHHHHHHHcccccHHHHHHccccccccHHHHHHHHHHHHHHcccHHHHccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHccHHHHHHHccccc //