[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : livG.2
DDBJ      :livG         branched-chain amino acid transport ATP-binding protein livG
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:249 amino acids
:PSIPRED
:BLT:PDB   4->248 1g6hA PDBj 4e-38 39.3 %
:RPS:PDB   4->248 2d3wB PDBj 2e-40 22.7 %
:RPS:SCOP  3->247 1ji0A  c.37.1.12 * 4e-45 31.2 %
:HMM:SCOP  4->247 1g6hA_ c.37.1.12 * 1.5e-62 38.7 %
:RPS:PFM   44->174 PF00005 * ABC_tran 5e-09 38.8 %
:HMM:PFM   44->175 PF00005 * ABC_tran 6.3e-21 32.8 116/118  
:HMM:PFM   226->247 PF12399 * BCA_ABC_TP_C 4.1e-09 59.1 22/23  
:HMM:PFM   13->61 PF03193 * DUF258 8.9e-06 31.2 48/161  
:BLT:SWISS 4->248 BRAF_PSEAE 1e-45 41.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80566.1 GT:GENE livG.2 GT:PRODUCT branched-chain amino acid transport ATP-binding protein livG GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(204864..205613) GB:FROM 204864 GB:TO 205613 GB:DIRECTION - GB:GENE livG GB:PRODUCT branched-chain amino acid transport ATP-binding protein livG GB:PROTEIN_ID AAS80566.1 GB:DB_XREF GI:46196148 GB:GENE:GENE livG LENGTH 249 SQ:AASEQ MGVILKVQDLHLSFKGVKALSGVAFSVAEGEFFAVIGPNGAGKTTLLNVLSGVYDPDRGEVVFLGQSLKGKSPQERARMGLGRTFQGLEIFRGMSVLENVKLGAELALPGYPMALPRAEKEWRLRAWAEEVLDYLHLSPFRHAPAGMLPYGLQKRVEVARALAGRPKLLLLDEPMAGLALEEKQDLARFLLDAREEWGVTLLWVEHDLRAVLELSDRVLVLSYGEVLYHGPPEGVKKDPKVVEAYLGQG GT:EXON 1|1-249:0| BL:SWS:NREP 1 BL:SWS:REP 4->248|BRAF_PSEAE|1e-45|41.1|241/255| BL:PDB:NREP 1 BL:PDB:REP 4->248|1g6hA|4e-38|39.3|239/254| RP:PDB:NREP 1 RP:PDB:REP 4->248|2d3wB|2e-40|22.7|242/244| RP:PFM:NREP 1 RP:PFM:REP 44->174|PF00005|5e-09|38.8|116/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 44->175|PF00005|6.3e-21|32.8|116/118|ABC_tran| HM:PFM:REP 226->247|PF12399|4.1e-09|59.1|22/23|BCA_ABC_TP_C| HM:PFM:REP 13->61|PF03193|8.9e-06|31.2|48/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 3->247|1ji0A|4e-45|31.2|234/240|c.37.1.12| HM:SCP:REP 4->247|1g6hA_|1.5e-62|38.7|243/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 45413 OP:NHOMOORG 1170 OP:PATTERN TSGBMMFIPONLPKTJlHSRPSRZsKNdiRdWH9ECEAGFHEBSaOWiNP*ze8TbSSXMRIJDX1A9 TWmM*aZckknXZTWSSNM-MfAAa*NNNNNTqlmls***T*V*p*wanhcP**vQSiFFop*c*o****gXWWWqaYZMxcpC7A8CPPNL7LEKE--FFRGIJbLUIP5666666ABA8888HQNFPUJHNOYQkppz*LLK*crgkyeejelTVNHMIKJhidi**zVHQFGFGFQEIEFmZdZXic8Ydx*******************xx***doz**gjwuusuu**UbbbZbXUYYbbbYYVRQVUwYYXurVNTQYqqKKzvZSSYdacdglimrkhouqqklkokhlokmmZZYXWZZZbaZYYvklcbbompfi*t*********d*ek***YXZV*hfli*YnTM**libchjVZgXkhPVYaPdTSSLGIHEIea***ZTt****************-lp*ic*n***PA**************IKN**********ONOOOOOO*ZeJRjU*66534555443344895454564465453JEDCDC***************z********q********BO**w*pzou******ZmkMYLQiaIJGFGFFRRMZrja**PZZxibmqedoKeYbSWXhSVYaZdy*a*KHFQDJIIJHD7C8888888BREDENMporMtXXHTItPVXYWOQaURRSVUXUWVa5-DMVON31-111****T*xw**zx*z*ww-*wvz*wyzwz**xrsvtrt*****hgcnoiklnmnmmjlnlkj*rllqqrtU2************23GGDECDEGHHHPK*j*XUYWWVILPKLSLRZLMMNMDSENSpbvvsuz***q****j***FDDADDDCDLgml*kllllw*xywRROKLKKHJIDDDD23QPNNIJJJ78787888*CSC9A5C-A7DBEF8CDD8EE8CA777ThpRPg*hgfGZM 1-11UZD-TG49FNHEDC69HJGICIFDCABACDDC798779A678C8AGGBMDDFA88CAB168374154376634-3457667531-7D6D878765663BJJG3CGQMLNIaNOHAB5AOKkj6h9**c3aNdFFE5UBDTQ8FBB9RB6*ERJHpEX*DbIN6*OR*KLLAEFE9*986DLhKN*8hS97fOcWP ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccEEEEccEEEEEccEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHcccccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccHHHHccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHcHHHHHHHcccc //