[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : livG.4
DDBJ      :livG         branched-chain amino acid transport ATP-binding protein livG
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  891/915 : Eukaryota  112/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:259 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->250 1g6hA PDBj 3e-31 32.4 %
:RPS:PDB   3->250 2d3wB PDBj 2e-32 16.7 %
:RPS:SCOP  3->250 1ji0A  c.37.1.12 * 6e-38 32.3 %
:HMM:SCOP  3->256 1g6hA_ c.37.1.12 * 1.4e-68 41.0 %
:RPS:PFM   43->102 PF00005 * ABC_tran 6e-04 42.9 %
:RPS:PFM   231->250 PF12399 * BCA_ABC_TP_C 3e-04 85.0 %
:HMM:PFM   43->179 PF00005 * ABC_tran 3.4e-26 38.8 116/118  
:HMM:PFM   230->251 PF12399 * BCA_ABC_TP_C 3.6e-15 81.8 22/23  
:HMM:PFM   25->53 PF03193 * DUF258 0.00077 21.4 28/161  
:BLT:SWISS 3->250 BRAF_PSEAE 3e-58 46.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81311.1 GT:GENE livG.4 GT:PRODUCT branched-chain amino acid transport ATP-binding protein livG GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 950910..951689 GB:FROM 950910 GB:TO 951689 GB:DIRECTION + GB:GENE livG GB:PRODUCT branched-chain amino acid transport ATP-binding protein livG GB:PROTEIN_ID AAS81311.1 GB:DB_XREF GI:46196896 GB:GENE:GENE livG LENGTH 259 SQ:AASEQ MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPLARKEERKALEEALSLLEYVGLLHRKDELARNLPYGEQRKLEIARALALKPKLLLLDEPAAGMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEAYLGRGAAGGAA GT:EXON 1|1-259:0| BL:SWS:NREP 1 BL:SWS:REP 3->250|BRAF_PSEAE|3e-58|46.4|248/255| SEG 120->137|larkeerkaleealslle| SEG 163->180|aralalkpklllldepaa| SEG 251->258|grgaagga| BL:PDB:NREP 1 BL:PDB:REP 1->250|1g6hA|3e-31|32.4|247/254| RP:PDB:NREP 1 RP:PDB:REP 3->250|2d3wB|2e-32|16.7|240/244| RP:PFM:NREP 2 RP:PFM:REP 43->102|PF00005|6e-04|42.9|56/123|ABC_tran| RP:PFM:REP 231->250|PF12399|3e-04|85.0|20/23|BCA_ABC_TP_C| HM:PFM:NREP 3 HM:PFM:REP 43->179|PF00005|3.4e-26|38.8|116/118|ABC_tran| HM:PFM:REP 230->251|PF12399|3.6e-15|81.8|22/23|BCA_ABC_TP_C| HM:PFM:REP 25->53|PF03193|0.00077|21.4|28/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 3->250|1ji0A|6e-38|32.3|232/240|c.37.1.12| HM:SCP:REP 3->256|1g6hA_|1.4e-68|41.0|251/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 19147 OP:NHOMOORG 1071 OP:PATTERN KJ85AA76AA88A6B7N5HGFGHLcABKTANO829885676738L8GFBBODB7DJGGGDF555K132 8BLAvB7CIHH6658B966-6I44Cm666669PJLKOYndKbIkHUD7JKF7QHO56F45LOl8bSSiagIFA99LFFA8J8W23516887626454--36D389C6IB61111111323222257A669668BE8QPOabAA9RMICJNCCPOUBB856756HJHKRPXD983453663555OMMKKML4EGOQQSQSVYbOZXUXWYTOKKJMWZXDRUMLHHKLLLLIin8AAA99989999A9A98966HC98SQ78B9CIF9ALOD67DHBEGFKIIDCBCGQNIKJIIHGKIJHBAAA9BBABBBAAGCCDDDDDDDLcNXbYZYaZXYHZIKUMLEEEDhMNE9jFFHDaXHKMKPLDJH7FNABCFDDCCCB27447GE***HBPthpsdefbjebhcdd*-LP*JExOhj*D3**************5ABec*pktwrXi98999999jHJ4BQJZ112-------112322424322222----C46473d*zcxlnrquoaSRTQnn**aXaZNcmp*lsre4CcdYjNZQUup*y**JRLBE6DJBA9AA999DBBGUQGgiGKGcOHQSLLWAHFFBDGG99NPMPSYKe668767677653333333331652275KLT6HDB595IAABBB7ADCCCBB9B7BF93-2695C-1----dVhaEdKVWWSVUPUTU-WUUVTTSUSTXSUSTUSSVrytbhEECMMKLLNMNNNLKNKLMfPNMPQNQA-Zefgihgcfhih224578888ABBBB6QPcDCDLBH67979CDHH789986F58AMHSSQQOffnPWYVUPfad7565656656ABAFCEDDEFICBC67857655552233117D99568955555455H4D43325-3322333655322465222FQPBDIYJPK6H9 ----231-2--234211--------------------1111-----111--2121-2---------------------------------21111--------------13562C374342363CA391Ab6-44F33225146625314812F4563H22A15121235B25413121-12213411E-341-6432- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 254-259| PSIPRED ccEEEEEcEEEEEccEEEEccccEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHcEEEEEEccEEEEEccHHHHHccHHHHHHHcccccccccc //