[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : lysR.1
DDBJ      :lysR         transcriptional regulatory protein, lysR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  215/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:285 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   115->237 2f97A PDBj 2e-12 34.1 %
:RPS:PDB   1->179 1bi3A PDBj 1e-10 8.4 %
:RPS:SCOP  1->38 1b9mA1  a.4.5.8 * 2e-08 23.7 %
:RPS:SCOP  115->232 1i69A  c.94.1.1 * 1e-11 25.5 %
:HMM:SCOP  1->102 1b9mA1 a.4.5.8 * 4.5e-21 43.9 %
:HMM:SCOP  83->286 1ixcA2 c.94.1.1 * 1.1e-24 30.2 %
:RPS:PFM   109->234 PF03466 * LysR_substrate 5e-04 27.4 %
:HMM:PFM   84->282 PF03466 * LysR_substrate 2.4e-33 31.0 197/209  
:HMM:PFM   4->59 PF00126 * HTH_1 1.4e-24 58.9 56/60  
:BLT:SWISS 1->237 BENM_ACIAD 5e-17 28.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82142.1 GT:GENE lysR.1 GT:PRODUCT transcriptional regulatory protein, lysR family GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1705811..1706668) GB:FROM 1705811 GB:TO 1706668 GB:DIRECTION - GB:GENE lysR GB:PRODUCT transcriptional regulatory protein, lysR family GB:PROTEIN_ID AAS82142.1 GB:DB_XREF GI:46197730 GB:GENE:GENE lysR LENGTH 285 SQ:AASEQ MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQALERELGVRLLERRPFRLTPAGDLLRREGARLLKELEALKEAVRRAGQEALRFGVPENLLPDLMPLLDHLRRGLGQAVEVLEMHTPEQVRALKEGRLDYGLAGLKVEDPEVAKEPLLRVPIVVALPETHPLAPRARVPLRALKEEPFLLLPKDFLPPLYEAFMEVFRRAGFAPKVVREVARFSQAVSLVAAGLGVHLTLAPYRVYPHPGVVLRPLEEEAALEVALIYARRPPPPRLEEVRRLLRALAL GT:EXON 1|1-285:0| BL:SWS:NREP 1 BL:SWS:REP 1->237|BENM_ACIAD|5e-17|28.3|237/304| SEG 39->51|lerelgvrllerr| SEG 61->79|llrregarllkelealkea| SEG 96->107|llpdlmplldhl| SEG 183->195|pflllpkdflppl| SEG 247->262|vvlrpleeeaaleval| SEG 265->284|arrpppprleevrrllrala| BL:PDB:NREP 1 BL:PDB:REP 115->237|2f97A|2e-12|34.1|123/216| RP:PDB:NREP 1 RP:PDB:REP 1->179|1bi3A|1e-10|8.4|179/211| RP:PFM:NREP 1 RP:PFM:REP 109->234|PF03466|5e-04|27.4|124/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 84->282|PF03466|2.4e-33|31.0|197/209|LysR_substrate| HM:PFM:REP 4->59|PF00126|1.4e-24|58.9|56/60|HTH_1| RP:SCP:NREP 2 RP:SCP:REP 1->38|1b9mA1|2e-08|23.7|38/122|a.4.5.8| RP:SCP:REP 115->232|1i69A|1e-11|25.5|110/206|c.94.1.1| HM:SCP:REP 1->102|1b9mA1|4.5e-21|43.9|98/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 83->286|1ixcA2|1.1e-24|30.2|202/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 294 OP:NHOMOORG 216 OP:PATTERN -------------------------------------------------------------------- -1--1----------------1---1----------1212-1------------1-----------2-1-------------4-------------------------1----------------------------11-------1--1----------------21-2-------------11111---1-1111111111111111--1111111-------------1----------------------------------11-----------------------------------------------------------------------------------------------------------------------1----------1111111-1---------11----111----1211--2----1-----------------11------------------------------------22---53133444432222222622222-34241421--21111-1-21--2--1-----1-----------------------1111-----------11-1-1------------------------------------------------------------------------11--12-1111111111-111111111111111111111111---11111111111111111111---1----1-111-1111-----------------1---------------1111111-1-2-2232-3-1--1---------------------------------1-11----------------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 241 STR:RPRED 84.6 SQ:SECSTR HHHHHHHHHHHHTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcTTccEEEcHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHTTTccHHHHHHHHHHcccccccTTccccTTHHHHTcccEEHHHHcccccEEEEEEEccGGGccccTHHHHHHHTTccTTcEEEEcccEEEcEEEEEEEEcTTccEEEEEEEGGGcTTccTTcEEEEEEcGGGcEEEcccEEEEEGcccc############################################ DISOP:02AL 285-286| PSIPRED ccHHHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHccEEEEccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEEEccccccccEEEEEEEEccEEEEEcccccccccccccHHHHccccEEEEccccccHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHccccEEEEEHHHHccccccEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHHcc //