[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : marR.3
DDBJ      :marR         transcriptional regulators, marR/emrR family
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:98 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->97 1ub9A PDBj 1e-06 35.3 %
:RPS:PDB   8->60 3bp8A PDBj 6e-04 14.0 %
:RPS:PDB   32->96 2e1nB PDBj 6e-07 15.4 %
:RPS:SCOP  11->60 1z6rA1  a.4.5.63 * 7e-04 12.8 %
:RPS:SCOP  32->94 1sfxA  a.4.5.50 * 2e-06 16.1 %
:HMM:SCOP  11->98 1ku9A_ a.4.5.36 * 1.7e-13 38.8 %
:HMM:PFM   12->60 PF01022 * HTH_5 2e-10 46.7 45/47  
:HMM:PFM   38->85 PF03551 * PadR 1.2e-06 33.3 48/86  
:BLT:SWISS 31->94 Y432_METJA 6e-12 46.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82172.1 GT:GENE marR.3 GT:PRODUCT transcriptional regulators, marR/emrR family GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1739689..1739985) GB:FROM 1739689 GB:TO 1739985 GB:DIRECTION - GB:GENE marR GB:PRODUCT transcriptional regulators, marR/emrR family GB:PROTEIN_ID AAS82172.1 GB:DB_XREF GI:46197760 GB:GENE:GENE marR LENGTH 98 SQ:AASEQ MPLALDPLIHQETRLRIVALLAGLGEGAKAEFTWLKEALGLTEGNLSSHLQKLEEAGYVRVEKGFRGKRPKTWVALTPEGRAAYEAYRKALLDLLQGR GT:EXON 1|1-98:0| BL:SWS:NREP 1 BL:SWS:REP 31->94|Y432_METJA|6e-12|46.9|64/92| SEG 19->28|allaglgega| BL:PDB:NREP 1 BL:PDB:REP 29->97|1ub9A|1e-06|35.3|68/100| RP:PDB:NREP 2 RP:PDB:REP 8->60|3bp8A|6e-04|14.0|50/381| RP:PDB:REP 32->96|2e1nB|6e-07|15.4|65/112| HM:PFM:NREP 2 HM:PFM:REP 12->60|PF01022|2e-10|46.7|45/47|HTH_5| HM:PFM:REP 38->85|PF03551|1.2e-06|33.3|48/86|PadR| RP:SCP:NREP 2 RP:SCP:REP 11->60|1z6rA1|7e-04|12.8|47/57|a.4.5.63| RP:SCP:REP 32->94|1sfxA|2e-06|16.1|62/109|a.4.5.50| HM:SCP:REP 11->98|1ku9A_|1.7e-13|38.8|85/151|a.4.5.36|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 70 OP:NHOMOORG 55 OP:PATTERN -------------------------11--1------1------------------------------- --1-2---11----------------------------------11--------------------------------------------21-111----21-1-11-11------------------21-11---1-------11----------------------------------------11-----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--144--------222-----121------------1111111--1----------------1-2---------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 91.8 SQ:SECSTR #######ccHHHHHHHHHHHHTTcccccHHHHHHHcTTEEccHHHHHHHHHHHHHTTcEEEEccTTccccEEEEEEccccccHHHHHHHHHHHHHHH# DISOP:02AL 1-2| PSIPRED ccccHHHHHccHHHHHHHHHHHcccccccccHHHHHHHHccccHHHHHHHHHHHHcccEEEEEcEEccccEEEEEEcHHHHHHHHHHHHHHHHHHccc //