[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : merR.1
DDBJ      :merR         probable transcriptional regulator, merR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  197/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:231 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->110 1q05A PDBj 7e-06 28.1 %
:BLT:PDB   133->199 1q05A PDBj 1e-04 30.9 %
:RPS:PDB   9->111 3d70A PDBj 1e-13 20.6 %
:RPS:PDB   128->198 3d70A PDBj 1e-12 21.9 %
:RPS:SCOP  14->86 1q05A  a.6.1.3 * 8e-11 29.2 %
:RPS:SCOP  133->205 1q05A  a.6.1.3 * 8e-11 28.4 %
:HMM:SCOP  11->103 1jbgA_ a.6.1.3 * 2.9e-18 43.5 %
:HMM:SCOP  130->229 1jbgA_ a.6.1.3 * 8.2e-19 41.4 %
:HMM:PFM   14->49 PF00376 * MerR 2.3e-12 52.8 36/38  
:HMM:PFM   133->168 PF00376 * MerR 2.3e-12 52.8 36/38  
:HMM:PFM   55->113 PF01442 * Apolipoprotein 9.9e-06 37.3 59/202  
:BLT:SWISS 7->84 HSPR_STRCO 5e-21 53.8 %
:BLT:SWISS 126->203 HSPR_STRCO 5e-21 53.8 %
:COIL
:REPEAT 2|2->91|121->210
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80480.1 GT:GENE merR.1 GT:PRODUCT probable transcriptional regulator, merR family GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 117218..117913 GB:FROM 117218 GB:TO 117913 GB:DIRECTION + GB:GENE merR GB:PRODUCT probable transcriptional regulator, merR family GB:PROTEIN_ID AAS80480.1 GB:DB_XREF GI:46196062 GB:GENE:GENE merR LENGTH 231 SQ:AASEQ MDKVVDKDRPVYVISVAAELVEMHPQTLRLYERKGLIKPKRSSGKTRLYSERDIEKLREIRRLTQELGVNLAGVEEIMRLRAELEALQARFEAEVARLKAEIGDRFQELERRALPPPGQTEKPSPKDRPVYVISVAAELVEMHPQTLRLYERKGLIKPKRSSGKTRLYSERDIEKLREIRRLTQELGVNLAGVEEIMRLRAELEALQARFEAEVARLKLLLLEKEEALGGG GT:EXON 1|1-231:0| BL:SWS:NREP 2 BL:SWS:REP 7->84|HSPR_STRCO|5e-21|53.8|78/151| BL:SWS:REP 126->203|HSPR_STRCO|5e-21|53.8|78/151| COIL:NAA 75 COIL:NSEG 2 COIL:REGION 71->105| COIL:REGION 190->229| NREPEAT 1 REPEAT 2|2->91|121->210| SEG 211->228|eaevarlkllllekeeal| BL:PDB:NREP 2 BL:PDB:REP 14->110|1q05A|7e-06|28.1|96/122| BL:PDB:REP 133->199|1q05A|1e-04|30.9|66/122| RP:PDB:NREP 2 RP:PDB:REP 9->111|3d70A|1e-13|20.6|102/276| RP:PDB:REP 128->198|3d70A|1e-12|21.9|70/276| HM:PFM:NREP 3 HM:PFM:REP 14->49|PF00376|2.3e-12|52.8|36/38|MerR| HM:PFM:REP 133->168|PF00376|2.3e-12|52.8|36/38|MerR| HM:PFM:REP 55->113|PF01442|9.9e-06|37.3|59/202|Apolipoprotein| RP:SCP:NREP 2 RP:SCP:REP 14->86|1q05A|8e-11|29.2|72/122|a.6.1.3| RP:SCP:REP 133->205|1q05A|8e-11|28.4|72/122|a.6.1.3| HM:SCP:REP 11->103|1jbgA_|2.9e-18|43.5|92/106|a.6.1.3|1/2|Putative DNA-binding domain| HM:SCP:REP 130->229|1jbgA_|8.2e-19|41.4|99/106|a.6.1.3|2/2|Putative DNA-binding domain| OP:NHOMO 220 OP:NHOMOORG 197 OP:PATTERN -------------------------------------------------------------------- 1111111111111124311-11112111111111112255122111111111212111111121111111111111111111211111---------------------------------------------------11111-1--------------------1----------------11111----11111111111111111--1111111111--1----------111111111111111------------------------------------------------------------------------------------------1---------------111-1----1---------1----------------------------------------------------------------------------------------------------------------------------------11111111111111-1111111-1-------------------------------------------------------------------------11111111111111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 192 STR:RPRED 83.1 SQ:SECSTR ########cccEEHHHHHHHHTccHHHHHHHHHTTccccEcTTTccEEEcGGGGGHHHHHHHHHHHHTccHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccH##cccEEHHHHHHHHTccHHHHHHHHHTTccccEcTTTccEEEcGGGGGHHHHHHHHHHHHTccHHHHHHHTTccHH############################# DISOP:02AL 1-9, 109-130, 203-207| PSIPRED cccccccccccccHHHHHHHHcccHHHHHHHHHHccccccccccccEEccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHccccHHHHHHHHcccHHHHHHHHHHccccccccccccEEccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccc //