[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : merR.2
DDBJ      :merR         transcriptional regulator, merR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  312/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->75 3gp4B PDBj 7e-11 39.4 %
:RPS:PDB   3->79 3d70A PDBj 1e-18 27.3 %
:RPS:SCOP  1->66 1j9iA  a.6.1.5 * 1e-18 22.7 %
:RPS:SCOP  47->79 1q08A  a.6.1.3 * 2e-07 30.3 %
:HMM:SCOP  3->129 1q06A_ a.6.1.3 * 9.5e-33 37.0 %
:RPS:PFM   4->41 PF00376 * MerR 3e-04 59.5 %
:HMM:PFM   47->109 PF09278 * MerR-DNA-bind 8.1e-19 39.7 63/65  
:HMM:PFM   4->41 PF00376 * MerR 2.9e-17 57.9 38/38  
:BLT:SWISS 3->82 MERR_THIFE 1e-14 45.0 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81137.1 GT:GENE merR.2 GT:PRODUCT transcriptional regulator, merR family GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(773178..773606) GB:FROM 773178 GB:TO 773606 GB:DIRECTION - GB:GENE merR GB:PRODUCT transcriptional regulator, merR family GB:PROTEIN_ID AAS81137.1 GB:DB_XREF GI:46196721 GB:GENE:GENE merR LENGTH 142 SQ:AASEQ MPYTIGELARAFGLSPDALRYYERLGLLAPSGRSPGGVRLYGEEAFRRLRFIKEAQAAGLKLEDIAWILRAVEEGHPPCRHVREALAKRLAEVRRRLRELQALEAALAERLAYAEAHPDPACDGRDRCVYLDPLDPGARSRV GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 3->82|MERR_THIFE|1e-14|45.0|80/122| COIL:NAA 30 COIL:NSEG 1 COIL:REGION 83->112| SEG 83->116|realakrlaevrrrlrelqaleaalaerlayaea| BL:PDB:NREP 1 BL:PDB:REP 5->75|3gp4B|7e-11|39.4|71/130| RP:PDB:NREP 1 RP:PDB:REP 3->79|3d70A|1e-18|27.3|77/276| RP:PFM:NREP 1 RP:PFM:REP 4->41|PF00376|3e-04|59.5|37/37|MerR| HM:PFM:NREP 2 HM:PFM:REP 47->109|PF09278|8.1e-19|39.7|63/65|MerR-DNA-bind| HM:PFM:REP 4->41|PF00376|2.9e-17|57.9|38/38|MerR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00376|IPR000551| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00376|IPR000551| RP:SCP:NREP 2 RP:SCP:REP 1->66|1j9iA|1e-18|22.7|66/68|a.6.1.5| RP:SCP:REP 47->79|1q08A|2e-07|30.3|33/94|a.6.1.3| HM:SCP:REP 3->129|1q06A_|9.5e-33|37.0|127/127|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 443 OP:NHOMOORG 313 OP:PATTERN -------------------------------------------------------------------- -111------12-2---11-11---211111-----11-3-443---2-1--234-1---124-2--211----------11------------------------------------------------------1-1-------311222-11-1------1-1-121-------------1--111----------------1-------------1-----------1-----------------1---------------------1--------------------------------------------------------1111111-1--1------------------------1--1--------1--2----------2131-1------------1-2311324111--1-11113--122-2-3---21-111-3111111112---1----------------------------------114--111-1123212----33111111-2312-124-1451-21223-4-1-121-----1-------13--11---------1-----1111-1-11-----1---------------------------13341252-2--1211111111--21-11211---1---------11--11-1111111111-1111111111111111111111---1111111211111311111111---1--111111111111---1----------2111---1---1111--1---1-3---1--1123111111111442------------1111-----111--21--------------------------------------------------------------------1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 57.0 SQ:SECSTR ccEEHHHHHHHHTccHHHHHHHHHTTcccccEcTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTccHHHHHHHHH############################################################# DISOP:02AL 136-142| PSIPRED ccccHHHHHHHHcccHHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccc //