[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : mraZ
DDBJ      :mraZ         mraZ protein
Swiss-Prot:MRAZ_THET8   RecName: Full=Protein mraZ;

Homologs  Archaea  0/68 : Bacteria  474/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.129.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->139 1n0fB PDBj 3e-16 35.3 %
:RPS:SCOP  1->139 1n0eA  b.129.1.2 * 2e-45 32.1 %
:HMM:SCOP  1->139 1n0eA_ b.129.1.2 * 9.6e-39 46.7 %
:RPS:PFM   4->59 PF02381 * MraZ 1e-08 42.9 %
:RPS:PFM   73->134 PF02381 * MraZ 2e-05 37.1 %
:HMM:PFM   3->70 PF02381 * MraZ 7.1e-22 33.8 68/72  
:HMM:PFM   72->131 PF02381 * MraZ 1.5e-13 37.9 58/72  
:BLT:SWISS 1->144 MRAZ_THET8 4e-83 100.0 %
:REPEAT 2|4->63|75->138

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81058.1 GT:GENE mraZ GT:PRODUCT mraZ protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 696128..696562 GB:FROM 696128 GB:TO 696562 GB:DIRECTION + GB:GENE mraZ GB:PRODUCT mraZ protein GB:PROTEIN_ID AAS81058.1 GB:DB_XREF GI:46196642 GB:GENE:GENE mraZ LENGTH 144 SQ:AASEQ MPFGEYQYSLDDKGRVVIPAPFRDFVEDGLVLTRGMEGCLYVFPLDRWKKIEEQLVNLPLTDAEARAFVRFFYSGAHKTRMDSASRVLIPPPLRLFAGLKEGGEVVIAGAPGRLEIWSQERWWKAIEEVLAKPPAPEALKGLVG GT:EXON 1|1-144:0| SW:ID MRAZ_THET8 SW:DE RecName: Full=Protein mraZ; SW:GN Name=mraZ; OrderedLocusNames=TTHA1075; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->144|MRAZ_THET8|4e-83|100.0|144/144| NREPEAT 1 REPEAT 2|4->63|75->138| BL:PDB:NREP 1 BL:PDB:REP 1->139|1n0fB|3e-16|35.3|133/139| RP:PFM:NREP 2 RP:PFM:REP 4->59|PF02381|1e-08|42.9|56/69|MraZ| RP:PFM:REP 73->134|PF02381|2e-05|37.1|59/69|MraZ| HM:PFM:NREP 2 HM:PFM:REP 3->70|PF02381|7.1e-22|33.8|68/72|MraZ| HM:PFM:REP 72->131|PF02381|1.5e-13|37.9|58/72|MraZ| RP:SCP:NREP 1 RP:SCP:REP 1->139|1n0eA|2e-45|32.1|137/141|b.129.1.2| HM:SCP:REP 1->139|1n0eA_|9.6e-39|46.7|137/0|b.129.1.2|1/1|AbrB/MazE/MraZ-like| OP:NHOMO 478 OP:NHOMOORG 475 OP:PATTERN -------------------------------------------------------------------- ---1111111111111111-11111111111111111111111111111111111111111111111---11111111----1----------------1-111111-11--------------------1-----2221111111-------------------------------------1111111-1-1---------------111111------11--11111111111111111111111111111-111111111111111111111-----------------------------------------------1111111111111111-------1111111111111111111111111---1-----------------------------------------------------------------------------------------------------------------------------111111111111111111111-11111111111-1---111111111111111111111111111111111-111-111-111111-1-11111111111111-------------------------11111-11111111111111111111111111---1111------11-11111111111-11-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111-1111111-111-1111------------1111111111111-------------1--------------111111111-1111------------------11-----1---1-111---11-1-1---------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 92.4 SQ:SECSTR ccccEEEEcccTTcEEEcccHHHHHcccEEccccccccccEEccHHHHHHHHHHHHTcccccHHHHHHHHHHHTTcccEEccTTcEEEccH##HHHHHTTccccEEEEEccccEEEEEH####HHHHHHHHccccHHHH##### DISOP:02AL 57-59| PSIPRED cccccccccccccccEEccHHHHHHHcccEEEEEcccccEEEccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccEEEEEcccccEEccHHHHHHHccccccEEEEEEcccEEEEccHHHHHHHHHHHHcccccHHHHHHHcc //