[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : mreC
DDBJ      :mreC         rod shape-determining protein mreC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:262 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   132->246 2j5uB PDBj 4e-09 32.2 %
:RPS:PFM   132->246 PF04085 * MreC 4e-13 40.9 %
:HMM:PFM   113->261 PF04085 * MreC 4.8e-26 30.9 149/154  
:HMM:PFM   65->101 PF06156 * DUF972 8.9e-05 45.9 37/107  
:BLT:SWISS 123->246 MREC_HAEIN 3e-05 25.0 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81172.1 GT:GENE mreC GT:PRODUCT rod shape-determining protein mreC GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 808785..809573 GB:FROM 808785 GB:TO 809573 GB:DIRECTION + GB:GENE mreC GB:PRODUCT rod shape-determining protein mreC GB:PROTEIN_ID AAS81172.1 GB:DB_XREF GI:46196756 GB:GENE:GENE mreC LENGTH 262 SQ:AASEQ MREHLLPRFLLAFLLALGLALAALTRPLAPGFALSFSPLTAFPLHLGHRLGQNLRAAWSALSARQDLLAENQRLKEEVARLTTENARLRLEVARLARALEVKAGQAPGVVAVAPVVAEDASGLYRRLVLGLGSQDGLRPGMPVTAPQGLVGLVVEVEAHRALVRTLLDPESRVGVRVGEKPGRGVARGAPPGLLVAEFPPTVAVAPGDLLLTGATLGLFPDGIPVGRVERVERAQGGLKVRAWARPLVDLSLLEEVVVLRPL GT:EXON 1|1-262:0| BL:SWS:NREP 1 BL:SWS:REP 123->246|MREC_HAEIN|3e-05|25.0|124/100| COIL:NAA 49 COIL:NSEG 1 COIL:REGION 54->102| SEG 5->31|llprfllafllalglalaaltrplapg| SEG 86->101|arlrlevarlaralev| SEG 103->117|agqapgvvavapvva| SEG 181->192|pgrgvargappg| SEG 209->218|llltgatlgl| SEG 247->259|lvdlslleevvvl| BL:PDB:NREP 1 BL:PDB:REP 132->246|2j5uB|4e-09|32.2|115/201| RP:PFM:NREP 1 RP:PFM:REP 132->246|PF04085|4e-13|40.9|115/152|MreC| HM:PFM:NREP 2 HM:PFM:REP 113->261|PF04085|4.8e-26|30.9|149/154|MreC| HM:PFM:REP 65->101|PF06156|8.9e-05|45.9|37/107|DUF972| GO:PFM:NREP 1 GO:PFM GO:0008360|"GO:regulation of cell shape"|PF04085|IPR007221| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------11-11---11--------------------------1--11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 43.9 SQ:SECSTR ###################################################################################################################################cGGGTccTTcEEEETTEEEEEEEEEccccEEEEETTcTTccEEEEEcccEEEEEEETTTTEEEEEEEETTccccTTcEEEEccTTccccTTcEEEEEEEEEEcTTccEEEEEEEE################ DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEcccccEEEEEEEcccccccccccEEEccccEEEEEEEEccEEEEEEEEEccccEEEEEEEcccEEEEEEEEcccEEEEEcccccccccccEEEEcccccccccccEEEEEEEEEEcccccEEEEEEEEccccccccEEEEEEcc //