[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : pilT.2
DDBJ      :pilT         pili retraction protein pilT
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  629/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:361 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->352 2ewvA PDBj 2e-96 54.9 %
:RPS:PDB   67->170 3cgiD PDBj 8e-08 15.5 %
:RPS:PDB   150->301 1dmaB PDBj 1e-27 8.1 %
:RPS:SCOP  1->306 1p9rA  c.37.1.11 * 2e-49 32.0 %
:HMM:SCOP  9->343 1p9rA_ c.37.1.11 * 2.4e-76 33.1 %
:RPS:PFM   10->273 PF00437 * GSPII_E 7e-38 44.0 %
:HMM:PFM   18->263 PF00437 * GSPII_E 1.8e-45 31.8 239/282  
:BLT:SWISS 6->349 PILT_PSEAE 8e-97 51.6 %
:PROS 197->211|PS00662|T2SP_E
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81963.1 GT:GENE pilT.2 GT:PRODUCT pili retraction protein pilT GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1540760..1541845) GB:FROM 1540760 GB:TO 1541845 GB:DIRECTION - GB:GENE pilT GB:PRODUCT pili retraction protein pilT GB:PROTEIN_ID AAS81963.1 GB:DB_XREF GI:46197550 GB:GENE:GENE pilT LENGTH 361 SQ:AASEQ MAKAPDVVDLLALAVERGASDLVITVGLPPMLKIDGEFHPTEYEPLTPQETRRLMYALMDEKQQRIFEEEKELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVPSAVKSFEELGLPKNIAEIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMRDYETIAAAITAAETGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGGRVLAYELMIATPAVRALIREGKTHQLRSVIQTGGQYGMITMDACLADLYRRKLITYEMGLARAVDPKEFMRLAGAPEGARR GT:EXON 1|1-361:0| BL:SWS:NREP 1 BL:SWS:REP 6->349|PILT_PSEAE|8e-97|51.6|343/344| PROS 197->211|PS00662|T2SP_E|PDOC00567| SEG 213->224|etiaaaitaaet| BL:PDB:NREP 1 BL:PDB:REP 18->352|2ewvA|2e-96|54.9|328/343| RP:PDB:NREP 2 RP:PDB:REP 67->170|3cgiD|8e-08|15.5|103/117| RP:PDB:REP 150->301|1dmaB|1e-27|8.1|148/189| RP:PFM:NREP 1 RP:PFM:REP 10->273|PF00437|7e-38|44.0|252/273|GSPII_E| HM:PFM:NREP 1 HM:PFM:REP 18->263|PF00437|1.8e-45|31.8|239/282|GSPII_E| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00437|IPR001482| GO:PFM GO:0005622|"GO:intracellular"|PF00437|IPR001482| GO:PFM GO:0006810|"GO:transport"|PF00437|IPR001482| RP:SCP:NREP 1 RP:SCP:REP 1->306|1p9rA|2e-49|32.0|291/378|c.37.1.11| HM:SCP:REP 9->343|1p9rA_|2.4e-76|33.1|320/401|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 2004 OP:NHOMOORG 636 OP:PATTERN ---------------------------------11--------------------------------- 153-------------------------------------5---3---3----3--------3-----------------3-346634-------------11---1-21111111111111111----------------444--6333333334431233333333333-3--2-23--2-444434422311111111111111-11111111113331122-------21111111111111111111111-1111111111111-11111---11111111111-----------111111111111121111111112222222222223232333333312411-3335336342332222222216561111-----211221---1--1------------111-61---1--1-----1------1122----------1111111111121--211---------------------------2-111-22--1422245244423322444424262445511557A996678CA79659799B524444444542A993877467--53333-AABD987996666975513333111111-1-------2454454665598546555567556555555555565--34558------32341243333344434-333535533334343344333333342222222224233232232131111--533333343933--A622222555545831111111111111111555652545256799755677444557672221122123477655545555557777A776664444--2-111111------------------------------------2212222222-84 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----3------1-----------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 340 STR:RPRED 94.2 SQ:SECSTR #################TccEEEEccccccEEEETTEEEcTTcccccccTTHHHccccGGGcccccccccccccTTcccccccHHHHTTTccHHTTTccGGGEEEcccccEEEcTHHTTccccEEEEEEEccccTTcccHHHHHHHHHHcccccTccccccTTcccTccHHHTTHHHHHHHHHTTTHEEEEEEEEEEHHHHHHHHHHccccccTTcTTccEEEcccHHHHTTccccccEEEEEEEEETTcGGGEEEccccTTcHHHHHHHHHHHTccccccccEEEEccccccccEEEEcHTTcHHHHccccEEEEcccccHHHHHHHHHTTcEEEEEEcccccccccccccccccc#### DISOP:02AL 1-2, 182-184, 351-354, 356-361| PSIPRED ccccccHHHHHHHHHHccccEEEEEcccEEEEEEccEEEEcccccccHHHHHHHHHHHHHHHHccHHHcccEEEEEEEEccccEEEEEEEEcccccEEEEEEcccccccHHHcccHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHcccccEEEEEEEccccccccccEEEEEccccccccccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHccccHHHHHHHHHHHHHHEEEEEEEEEEEccccEEEEEEEEEccHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHHccccccc //