[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : rodA
DDBJ      :rodA         rod shape-determining protein rodA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  717/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:359 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   196->338 PF01098 * FTSW_RODA_SPOVE 4e-30 48.6 %
:HMM:PFM   18->356 PF01098 * FTSW_RODA_SPOVE 7.2e-95 41.7 338/359  
:BLT:SWISS 199->338 RODA_HAEIN 6e-28 43.6 %
:PROS 314->338|PS00428|FTSW_RODA_SPOVE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81221.1 GT:GENE rodA GT:PRODUCT rod shape-determining protein rodA GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(851929..853008) GB:FROM 851929 GB:TO 853008 GB:DIRECTION - GB:GENE rodA GB:PRODUCT rod shape-determining protein rodA GB:PROTEIN_ID AAS81221.1 GB:DB_XREF GI:46196806 GB:GENE:GENE rodA LENGTH 359 SQ:AASEQ MAPARPNWLAYDWGLVFLVAAIVALGFVNLGSAAPDPALLYRQSVALGLGLLLAFLLQFLSRRRLFGLAYPLYGASLLLLALVLVVGREINGARAWFVLGPLQFQPLELAKLGLLLALAKALEGRPIARVWDYALPALLTLPVVGLLLLQPDLGGALVVLFGVFVVVFVRGLPWRHLLVGLFALALLVPTAVWPNLKPYQRERVLIVLDPYRDPLGQGFQVIQSTIAIGSGGLFGKGYGQGTQAQLGFIPFRHTDFVFSVWAEEWGFVGVVGLLGLYGLLLARLFALALACPRLSDRLFLSGFAGMLGFQVVVNLGVALGVMPVTGLTLPLFSYGGSSLIATLAGLGLVLLVHRDRYQD GT:EXON 1|1-359:0| BL:SWS:NREP 1 BL:SWS:REP 199->338|RODA_HAEIN|6e-28|43.6|140/371| PROS 314->338|PS00428|FTSW_RODA_SPOVE|PDOC00352| TM:NTM 9 TM:REGION 11->33| TM:REGION 39->61| TM:REGION 74->96| TM:REGION 104->126| TM:REGION 143->165| TM:REGION 174->196| TM:REGION 269->291| TM:REGION 304->326| TM:REGION 332->353| SEG 47->87|lglglllafllqflsrrrlfglayplygasllllalvlvvg| SEG 107->124|lelaklglllalakaleg| SEG 134->169|alpalltlpvvgllllqpdlggalvvlfgvfvvvfv| SEG 177->188|llvglfalallv| SEG 266->290|gfvgvvgllglyglllarlfalala| SEG 339->352|liatlaglglvllv| RP:PFM:NREP 1 RP:PFM:REP 196->338|PF01098|4e-30|48.6|142/357|FTSW_RODA_SPOVE| HM:PFM:NREP 1 HM:PFM:REP 18->356|PF01098|7.2e-95|41.7|338/359|FTSW_RODA_SPOVE| GO:PFM:NREP 2 GO:PFM GO:0007049|"GO:cell cycle"|PF01098|IPR001182| GO:PFM GO:0016021|"GO:integral to membrane"|PF01098|IPR001182| OP:NHOMO 1096 OP:NHOMOORG 718 OP:PATTERN -------------------------------------------------------------------- 22111----------------------------111--11111----1--------------1-1--1111-------2112212121111111112--22121211112-------212111111111111111122213----122122212222222222212222221211222221221--11112322222223323332443434421234232322111111132111111111111111111111211--11121111111-1--111111111---12211111111111----------------111---22221222222221211111222223212321222223122212222211111-211211111--11111--1-1-------------11-111111-1-1--111111111111111111111111111111111111121122--------11111111111111111111111111111112211111111111111111111111111111111122211122112222222111111122122222221221212111222212221111111122-------------------------112212222222122222123222222322221-2112211-11122222222222222222-2232222222222122222222222222222222222222222222222222222222222222212211111111112211211121211111211122222221112211112222122222222---------233322222233222332222222222221-111111112111111122---------------------------111-11121111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 356-359| PSIPRED ccccHHHHHHccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccEEcHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHccccccHHHHHHHHHHHccccEEEEccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHccHHHHHHHHHHHHHHHHHHHHcccc //