[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : rpoZ
DDBJ      :rpoZ         RNA polymerase-associated protein rpoZ, omega subunit
Swiss-Prot:RPOZ_THET8   RecName: Full=DNA-directed RNA polymerase subunit omega;         Short=RNAP omega subunit;         EC=2.7.7.6;AltName: Full=Transcriptase subunit omega;AltName: Full=RNA polymerase omega subunit;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.143.1
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->96 2o5iE PDBj 3e-52 100.0 %
:RPS:SCOP  2->96 1iw7E  a.143.1.1 * 4e-17 96.8 %
:HMM:SCOP  1->98 1i6vE_ a.143.1.1 * 9.7e-23 31.6 %
:HMM:PFM   8->43 PF01192 * RNA_pol_Rpb6 1.7e-09 37.1 35/57  
:BLT:SWISS 1->99 RPOZ_THET8 4e-54 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81538.1 GT:GENE rpoZ GT:PRODUCT RNA polymerase-associated protein rpoZ, omega subunit GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1159911..1160210) GB:FROM 1159911 GB:TO 1160210 GB:DIRECTION - GB:GENE rpoZ GB:PRODUCT RNA polymerase-associated protein rpoZ, omega subunit GB:PROTEIN_ID AAS81538.1 GB:DB_XREF GI:46197124 GB:GENE:GENE rpoZ LENGTH 99 SQ:AASEQ MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLVPEDRLQKEMERLYPVEREE GT:EXON 1|1-99:0| SW:ID RPOZ_THET8 SW:DE RecName: Full=DNA-directed RNA polymerase subunit omega; Short=RNAP omega subunit; EC=2.7.7.6;AltName: Full=Transcriptase subunit omega;AltName: Full=RNA polymerase omega subunit; SW:GN Name=rpoZ; OrderedLocusNames=TTHA1561; SW:KW 3D-structure; Complete proteome; DNA-directed RNA polymerase;Nucleotidyltransferase; Transcription; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->99|RPOZ_THET8|4e-54|100.0|99/99| GO:SWS:NREP 4 GO:SWS GO:0003899|"GO:DNA-directed RNA polymerase activity"|DNA-directed RNA polymerase| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 2->96|2o5iE|3e-52|100.0|95/95| HM:PFM:NREP 1 HM:PFM:REP 8->43|PF01192|1.7e-09|37.1|35/57|RNA_pol_Rpb6| RP:SCP:NREP 1 RP:SCP:REP 2->96|1iw7E|4e-17|96.8|95/95|a.143.1.1| HM:SCP:REP 1->98|1i6vE_|9.7e-23|31.6|98/0|a.143.1.1|1/1|RPB6/omega subunit-like| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 98 STR:RPRED 99.0 SQ:SECSTR cccTTHHHHHHHcccHHHHHHHHHHHHHHHHHTcTTccccccccccccccccGGGTccccHHHHHHHHTTTccccccccccTTHHHHHHHHHcccccc# DISOP:02AL 1-3, 95-99| PSIPRED cccccHHHHHHHHcccEEEHHHHHHHHHHHHHccccccccccccccHHHHHHHHccccHHHHHHHHHHHcccEEEccccccHHHHHHHHHHHccccccc //