[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : surE.1
DDBJ      :surE         survival protein surE
Swiss-Prot:SURE1_THET2  RecName: Full=5'-nucleotidase surE 1;         EC=3.1.3.5;AltName: Full=Nucleoside 5'-monophosphate phosphohydrolase 1;

Homologs  Archaea  47/68 : Bacteria  574/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
c.106.1
:251 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->234 2e6cC PDBj 1e-57 55.8 %
:RPS:PDB   1->242 2e6cA PDBj 3e-80 50.2 %
:RPS:SCOP  2->245 1ilvA  c.106.1.1 * 1e-79 44.0 %
:HMM:SCOP  1->248 1l5xA_ c.106.1.1 * 3.3e-81 55.5 %
:RPS:PFM   1->178 PF01975 * SurE 4e-34 54.5 %
:HMM:PFM   1->185 PF01975 * SurE 3.9e-64 53.5 185/197  
:HMM:PFM   190->201 PF00397 * WW 0.00088 58.3 12/30  
:BLT:SWISS 1->251 SURE1_THET2 e-131 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81967.1 GT:GENE surE.1 GT:PRODUCT survival protein surE GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1545769..1546524) GB:FROM 1545769 GB:TO 1546524 GB:DIRECTION - GB:GENE surE GB:PRODUCT survival protein surE GB:PROTEIN_ID AAS81967.1 GB:DB_XREF GI:46197554 GB:GENE:GENE surE LENGTH 251 SQ:AASEQ MRILVSNDDGIFSPGIKALGLAMRALGEVFVVAPDMEQSAVGHGITVRRPLRFKHTQSAGFGEIPAYRVDGTPADCVVLGVHLLGRPDLVVSGINLGVNLGLDLTHSGTVAAALEGASLGIPSIAFSLDTSGEVLDFQEAARWALAIARAVGERGLPPGVLLNVNFPASRPKGLLVTRLSTHRFEDQVVERLDPEGKPYYWIAGTPAGEEEEGTDLWAVRRGYVSVTPVSLDLTAHGFLEALSGLLEGVAP GT:EXON 1|1-251:0| SW:ID SURE1_THET2 SW:DE RecName: Full=5'-nucleotidase surE 1; EC=3.1.3.5;AltName: Full=Nucleoside 5'-monophosphate phosphohydrolase 1; SW:GN Name=surE1; OrderedLocusNames=TT_C1625; SW:KW Complete proteome; Cytoplasm; Hydrolase; Metal-binding;Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->251|SURE1_THET2|e-131|100.0|251/251| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| SEG 140->150|aarwalaiara| SEG 208->213|geeeeg| BL:PDB:NREP 1 BL:PDB:REP 1->234|2e6cC|1e-57|55.8|231/238| RP:PDB:NREP 1 RP:PDB:REP 1->242|2e6cA|3e-80|50.2|239/243| RP:PFM:NREP 1 RP:PFM:REP 1->178|PF01975|4e-34|54.5|176/193|SurE| HM:PFM:NREP 2 HM:PFM:REP 1->185|PF01975|3.9e-64|53.5|185/197|SurE| HM:PFM:REP 190->201|PF00397|0.00088|58.3|12/30|WW| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01975|IPR002828| RP:SCP:NREP 1 RP:SCP:REP 2->245|1ilvA|1e-79|44.0|241/246|c.106.1.1| HM:SCP:REP 1->248|1l5xA_|3.3e-81|55.5|245/276|c.106.1.1|1/1|SurE-like| OP:NHOMO 715 OP:NHOMOORG 645 OP:PATTERN 11---1----------21222221111121211111111111111111111111---11111--1--- -----------------------------------------1---1---------1--------1-----------------11-11111111111---1111112121211111111211111111111111111222--1111-22222212211111111221122231111111111111112311-1---------------------------------------1--------------------------------------------------------------------------------------------1--11111111111--11-----1---1--111111111111111-1--1121111-----111111111111111111111111-111111111111111111111111111111111111111---------1---1211111111111---------------1111-1-111111112222221111122221111112112132-1111111111111111111111111111111111111-1-1-111111112111111111111111111111111111111111111111111111111-1-111111111111111111111111--11111------11--1111111111111-1111111111111111111111--21111111111111111111111111111111111111111---11111111111-1111111111111111111111111-1-1-11111112111111111---------11111111111111111111111111111111-111111---------11-------------------------1111111111-1- -----------1---1--------1---------11------------11--1-------------------1----------------14------------------------------------------------------------------------------------11213---1-2234-31--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 249 STR:RPRED 99.2 SQ:SECSTR cEEEEEccccTTcHHHHHHHHHHTTTcEEEEEEEcccccccccccccccccEEEccccTTcccccEEEEEccHHHHHHHHHHHcccccEEEEEEEEccccGGGGGGcHHHHHHHHHHHTTcEEEEEEEccccccccHHHHHHHHHHHHHHHTTcccccccEEEEEcccccccEEEEcccccccEEccEEEEEcTTccEEEEEccEEcccccTTcHHHHHHTTEEEEEEcccccccTTcccccTGGHHHT## PSIPRED cEEEEEccccccccHHHHHHHHHHccccEEEEccccccccccccccccccEEEEEcccccccccEEEEEcccHHHHHHHHHHccccccEEEEcccccccccHHHHHcHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccEEEEEccccccccccEEEEcccccEEEEEccccccccccccHHHHHHcccEEEEccccccccHHHHHHHHHHHHcccc //