[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : tatA
DDBJ      :tatA         Sec-independent protein translocase protein tatA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   19->52 PF02416 * MttA_Hcf106 4e-04 58.8 %
:HMM:PFM   3->52 PF02416 * MttA_Hcf106 6.1e-24 60.0 50/53  
:BLT:SWISS 3->57 TATA_MOOTA 2e-09 61.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80366.1 GT:GENE tatA GT:PRODUCT Sec-independent protein translocase protein tatA GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 16863..17084 GB:FROM 16863 GB:TO 17084 GB:DIRECTION + GB:GENE tatA GB:PRODUCT Sec-independent protein translocase protein tatA GB:PROTEIN_ID AAS80366.1 GB:DB_XREF GI:46195948 GB:GENE:GENE tatA LENGTH 73 SQ:AASEQ MNLGMPEILVILLVALLIFGPRKLPELGRSLGQSIREFKRGAQEIREELEKSIEVKDEPKPAAAQEAKEEPKA GT:EXON 1|1-73:0| BL:SWS:NREP 1 BL:SWS:REP 3->57|TATA_MOOTA|2e-09|61.8|55/73| SEG 8->18|ilvillvalli| SEG 58->72|epkpaaaqeakeepk| RP:PFM:NREP 1 RP:PFM:REP 19->52|PF02416|4e-04|58.8|34/83|MttA_Hcf106| HM:PFM:NREP 1 HM:PFM:REP 3->52|PF02416|6.1e-24|60.0|50/53|MttA_Hcf106| GO:PFM:NREP 2 GO:PFM GO:0008565|"GO:protein transporter activity"|PF02416|IPR003369| GO:PFM GO:0015031|"GO:protein transport"|PF02416|IPR003369| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 40-73| PSIPRED ccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccc //