[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : tatC
DDBJ      :tatC         Sec-independent protein translocase protein tatC
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  658/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
:246 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->222 PF00902 * TatC 5e-27 38.8 %
:HMM:PFM   7->222 PF00902 * TatC 1.8e-70 43.0 214/214  
:BLT:SWISS 9->235 TATC_CAMJE 5e-34 34.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80367.1 GT:GENE tatC GT:PRODUCT Sec-independent protein translocase protein tatC GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 17081..17821 GB:FROM 17081 GB:TO 17821 GB:DIRECTION + GB:GENE tatC GB:PRODUCT Sec-independent protein translocase protein tatC GB:PROTEIN_ID AAS80367.1 GB:DB_XREF GI:46195949 GB:GENE:GENE tatC LENGTH 246 SQ:AASEQ MKEAPLVEHLEELRARILWSLLAWAVGTGVAWTFRVQLLEWLKRPLDLAAKAHGIQVNLIVLDITEPFLVSLKVAAFGGLVLALPFIVYQVWAFIAPGLYEHEKRLAVPFLLGAGFSFALGALFAYYAFLPFAVPFLLGFLGDVVTPQISIGRYMGQILMMLTVMGVVFEMPVVSYLLARLGILTSSFLARNWRIAVVLLLTLAAFITPTVDVVSLFIVSGPLLVLYWVSVLVARLAERQRPQEAA GT:EXON 1|1-246:0| BL:SWS:NREP 1 BL:SWS:REP 9->235|TATC_CAMJE|5e-34|34.8|224/245| TM:NTM 7 TM:REGION 10->32| TM:REGION 53->75| TM:REGION 79->101| TM:REGION 106->128| TM:REGION 130->152| TM:REGION 162->184| TM:REGION 204->226| SEG 109->133|pfllgagfsfalgalfayyaflpfa| RP:PFM:NREP 1 RP:PFM:REP 7->222|PF00902|5e-27|38.8|214/215|TatC| HM:PFM:NREP 1 HM:PFM:REP 7->222|PF00902|1.8e-70|43.0|214/214|TatC| OP:NHOMO 729 OP:NHOMOORG 688 OP:PATTERN ------1----------1--11---11-1--1------------------111---------11--11 112111111111-111111-1111111111111111111111111111111-111-11111111111111--------1--11111111111-1-----11111112111---------------111111111111111111111111111111111111111111111111111111111111111---11211111111111111112221211111121111-11--121--111-1---------------------------------------------1--------------------------1--111-----11--------------------1----1--111111111111------1111111--1111111111111111111111111111-111111-1111-1111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111----1111-----1-1111111111111111111111111-22111111111111111111112111111111111121111-11111111111111111111111111111111111111111212111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11---------1111111111111111111111111121121111111111122221111---------11111111111111111111111111111111-------------------------------------------------------1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------11H111113112-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 238-239, 241-246| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcc //