[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : thiS
DDBJ      :thiS         putative thiS protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.15.3
:64 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->64 2cu3B PDBj 9e-17 70.5 %
:RPS:PDB   2->60 2cu3A PDBj 2e-19 100.0 %
:RPS:SCOP  2->63 2cu3A1  d.15.3.2 * 7e-24 96.8 %
:HMM:SCOP  1->63 1tygB_ d.15.3.2 * 5.5e-11 41.3 %
:HMM:PFM   2->64 PF02597 * ThiS 4.6e-13 38.7 62/78  
:BLT:SWISS 4->64 THIG_MAGSA 1e-04 36.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80664.1 GT:GENE thiS GT:PRODUCT putative thiS protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 302989..303183 GB:FROM 302989 GB:TO 303183 GB:DIRECTION + GB:GENE thiS GB:PRODUCT putative thiS protein GB:PROTEIN_ID AAS80664.1 GB:DB_XREF GI:46196247 GB:GENE:GENE thiS LENGTH 64 SQ:AASEQ MVWLNGEPRPLEGKTLKEVLEEMGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALMQGG GT:EXON 1|1-64:0| BL:SWS:NREP 1 BL:SWS:REP 4->64|THIG_MAGSA|1e-04|36.1|61/100| BL:PDB:NREP 1 BL:PDB:REP 2->64|2cu3B|9e-17|70.5|61/61| RP:PDB:NREP 1 RP:PDB:REP 2->60|2cu3A|2e-19|100.0|58/60| HM:PFM:NREP 1 HM:PFM:REP 2->64|PF02597|4.6e-13|38.7|62/78|ThiS| RP:SCP:NREP 1 RP:SCP:REP 2->63|2cu3A1|7e-24|96.8|62/63|d.15.3.2| HM:SCP:REP 1->63|1tygB_|5.5e-11|41.3|63/0|d.15.3.2|1/1|MoaD/ThiS| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 63 STR:RPRED 98.4 SQ:SECSTR #EEETTEEEccTTccHHHHHHHTTccGGGEEEEETTEEEEGGGcccccccTTcEEEEEEccccc DISOP:02AL 64-65| PSIPRED cEEEcccEEEcccccHHHHHHHccccccEEEEEEcccEEEccccccEEcccccEEEEEEEcccc //