[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : tolQ
DDBJ      :tolQ         tolQ protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   42->101 PF01618 * MotA_ExbB 1e-08 55.0 %
:HMM:PFM   41->102 PF01618 * MotA_ExbB 8.6e-19 51.6 62/139  
:BLT:SWISS 45->101 TOLQ_SHIFL 3e-09 47.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80673.1 GT:GENE tolQ GT:PRODUCT tolQ protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(310588..310938) GB:FROM 310588 GB:TO 310938 GB:DIRECTION - GB:GENE tolQ GB:PRODUCT tolQ protein GB:PROTEIN_ID AAS80673.1 GB:DB_XREF GI:46196256 GB:GENE:GENE tolQ LENGTH 116 SQ:AASEQ MSGAELIRAAGPVFWILFALSVYTLYLVLAGLFRRKATARTLDRLGDLAQFAPLLGLFGTSLGMIRAFLALGQGGNPELLAQGIAEALTNTGMGLFVAVVAYGGRVLLGAMEGGEE GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 45->101|TOLQ_SHIFL|3e-09|47.4|57/230| TM:NTM 2 TM:REGION 11->33| TM:REGION 92->114| RP:PFM:NREP 1 RP:PFM:REP 42->101|PF01618|1e-08|55.0|60/132|MotA_ExbB| HM:PFM:NREP 1 HM:PFM:REP 41->102|PF01618|8.6e-19|51.6|62/139|MotA_ExbB| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF01618|IPR002898| GO:PFM GO:0008565|"GO:protein transporter activity"|PF01618|IPR002898| GO:PFM GO:0016020|"GO:membrane"|PF01618|IPR002898| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------1------------------------------------------------1------------------------------------------------11-11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------1------------------------1111--1-111---------1111---1-----------1-1----------------------1----------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 32-35, 115-116| PSIPRED ccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //