REPEAT (org=bsub0&id=CAB11952.2)

>CAB11952.2 bsub0 ybbR GIB00011CH01 "conserved hypothetical protein"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        483
#NPREPATH      2
#NNOVPATH      1
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      2
#SEGMENT  1   120 ->   212 type S Sc  112 SqID  25.8 Zsc   6.1
#SEGMENT  2   213 ->   303 type M Sc  576 SqID 100.0 Zsc  54.0
#ALIGNMENT
1     120:DGLTISINPSVTTVTIQERT-TKSFPVEVEYYNKSKMKKGYSPEQPIVSPKNVQITGSKN:  178
2     213:NALPVDVEPSVIKITVPVTSPSKKVPFKIER--TGSLPDGVSIANIESSPSEVTVYGSQD:  270
         :..*.....***...*.......*..*...*.  ......*.*......**..*...**..

1     179:VIDNISLVKA-SVNLENADETIEKEAKVTVYDKDG:  212
2     271:VLDSLEFIDGVSLDLSKINKDSDIEADIPL--PDG:  303
         :*.*........*..*.........**....  .**


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
       :      +      :      +       :      +      :      +       :    |483 aa
                111111111111112222222222222                           |#1|2 seg
//