REPEAT (org=cper0&id=BAB81626.1)

>BAB81626.1 cper0 CPE1920 GIB00075CH01 "hypothetical protein"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        116
#NPREPATH      1
#NNOVPATH      1
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      2
#SEGMENT  1    14 ->    44 type S Sc   47 SqID  30.0 Zsc   2.4
#SEGMENT  2    48 ->    77 type M Sc  197 SqID 100.0 Zsc  25.3
#ALIGNMENT
1      14:RNYSDAINYYKKALDNDECKCHSYYNAGVCY:   44
2      48:KQYEKAIEMITKALELYQ-DSKYFFNLAYCY:   77
         :..*..**....***.... ......*...**


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
                              :                             +         |116 aa
        111111111111111111  222222222222222222                        |#1|2 seg
//